DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Vcl

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_006518985.1 Gene:Vcl MGIID:98927 Length:1134 Species:Mus musculus

Alignment Length:1131 Identity:170/1132 (15%)
Similarity:321/1132 (28%) Gaps:467/1132 (41%)


  Fly    38 AVERFITIGEIIAEENID--IKGDMYEAAKEARDAGKSIERLCDISPLSGMELRHHIEPLKDYGA 100
            ||...:.:|:...:...|  :|.||..|..:..:|...:.:...:     ::...:..|.:||  
Mouse    50 AVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQM-----LQSDPYSVPARDY-- 107

  Fly   101 IILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELA 165
            :|..:|.:||..:.:||..|...|:|::...|...|.|...|.|....:.|......|..|.::|
Mouse   108 LIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMA 172

  Fly   166 YLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAMD 230
            .:....:.....:..|..:.::...:::.:.:|:::.|                           
Mouse   173 KMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMK--------------------------- 210

  Fly   231 LIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSD 295
             |....|:|     |:...|:...|.|:..|.:...|..|:.::     |::.::.....:.:::
Mouse   211 -IFVTTKNS-----KNQGIEEALKNRNFTVEKMSAEINEIIRVL-----QLTSWDEDAWASKDTE 264

  Fly   296 AY---FSFLDDDL-----WKSEKNL-PSAAG------------------GGR----MVNNTNFRK 329
            |.   .:.:|..|     |..:.|. |..||                  .|:    ::.......
Mouse   265 AMKRALASIDSKLNQAKGWLRDPNASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLG 329

  Fly   330 HLSSESLDLR---------------------EELSLAFEKLFEKAHDFTDSPY-------ISHN- 365
            .::.:..|||                     :.|:...|....|....|:|..       .:.| 
Mouse   330 QMTDQVADLRARGQGASPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNW 394

  Fly   366 -------------------HRKNILSYCDNCKLEFDLY--------LNTIMKDQHEGGGG----- 398
                               ..:.|...||:.|...|:.        |.:.:.|....|.|     
Mouse   395 LADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEIAALTSKLGDLRRQGKGDSPEA 459

  Fly   399 ----------------------------------AGGV--------------GGVGGGQVKG--- 412
                                              .|.:              .|||...::|   
Mouse   460 RALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVA 524

  Fly   413 -------------RSDPELGMLSSLEELCKQL-------------VVSVSSQIEDFNESLKI--- 448
                         |.| .|.....:::|..||             ..:::||::|..:.||.   
Mouse   525 EGHRLANVMMGPYRQD-LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKAQMQ 588

  Fly   449 -------------CSKLVKSFHVLAT-NYDIDN----LNQRSSKFHDCCDHIFDICKLLQHI--- 492
                         .:..:|...|.|| ..|..|    .::|::.|.:....:....:....:   
Mouse   589 EAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGRLGATAEKAAAVGTA 653

  Fly   493 --APTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMW------------ 543
              :..|.:|...|    ..|...|||..||:||.:...:.||.|:||:..:.|            
Mouse   654 NKSTVEGIQASVK----TARELTPQVISAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVD 714

  Fly   544 --------------------------------KWLTNEISMIAKK----ILVSINTTKGDRDAD- 571
                                            :.|....:.||::    :||:....:...|.. 
Mouse   715 EAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKF 779

  Fly   572 AEKCESSSDKLTK---------------------------SGV---------------------- 587
            .|..:::||:|:|                           ||.                      
Mouse   780 REAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPP 844

  Fly   588 ---------------------------------PATEDGEMVEYSGLEGKNN------GDLNTYQ 613
                                             |..:|.|..|....|..|.      ..|:...
Mouse   845 PPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEA 909

  Fly   614 SKWS-----------------------------EDLSDD-------------------------- 623
            .|||                             .|:.||                          
Mouse   910 RKWSSKPGIPAAQVGIGVVAEANAADAVGFPFPSDMEDDYEPELLLMPSNQPVNQPILAAAQSLH 974

  Fly   624 ----------NDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFS 678
                      |||:..||.|:.:...|.:..:|...  |.:.|...|:..|:.::.:.::.:..:
Mouse   975 REATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSG--TKRALIQCAKDIAKASDEVTRLAKEVA 1037

  Fly   679 YQVPASDNKKDLLNILDRVPTFVQALQF--TVKDHTVGKA---------ATFVKVDHVIRETKNL 732
            .|......:.:||.:.:|:||....|:.  |||...:|:.         ||    :.::...:||
Mouse  1038 KQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQAT----EMLVHNAQNL 1098

  Fly   733 MNVINKVVSKCFECATKYKLNLTGIT 758
            |..:.:.|.:....:.|.:.: .|.|
Mouse  1099 MQSVKETVREAEAASIKIRTD-AGFT 1123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 165/1113 (15%)
VclXP_006518985.1 Vinculin 66..1134 CDD:279395 167/1116 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.