DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Ctnna3

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001157848.1 Gene:Ctnna3 MGIID:2661445 Length:895 Species:Mus musculus

Alignment Length:843 Identity:181/844 (21%)
Similarity:318/844 (38%) Gaps:223/844 (26%)


  Fly    46 GEIIAEENIDIKGDMYEAAKEARDAGK----SIERLCDISPLSGMELRHHIEP--LKDYGAIILA 104
            ||:||:|...:|.::..|.:|.|...|    |.||..|             :|  |....|::.|
Mouse    73 GEMIAKEATVLKEELAAALQEVRKESKALKVSAERFTD-------------DPCYLPKREAVVQA 124

  Fly   105 ARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELAYLTG 169
            ||:||::|||:|:|.|:|.|..||........:.|.|::|.|.::..|.:...|.|:..|.||..
Mouse   125 ARALLAAVTRLLVLADMIDVMCLLQHVSSFQRTFESLKNVSNKSDLQRTYQKLGKELESLDYLAF 189

  Fly   170 HHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAMDLIHF 234
            ..:...|...:|.::..||..|:::..:|.:.....|.|||...:|.::|||..:|:.|:|:|  
Mouse   190 KRQQDLKSPSQRDEIAGARATLKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALDVI-- 252

  Fly   235 VVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSDAYFS 299
                    :......:...:.|..:..::.:....:.|||......::                 
Mouse   253 --------SNASQGIQNAPAPPEPQAATLGSAFDELENLIVLNPLTVT----------------- 292

  Fly   300 FLDDDLWKS-EKNLPSAAGGGRMVNNTNFRKHLSSESL------------DLREE---------- 341
              ::|:..| ||.|.:...|..::.:::..:.|..|.:            ||..|          
Mouse   293 --EEDVRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLTEYMSNTGKTER 355

  Fly   342 ---LSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTI-----------MKDQ 392
               |:.|...:.:|..|      :....||.|:.:..:..|:..:.|..:           :||.
Mouse   356 SNTLNTAIVNMSKKTRD------LRRQLRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDY 414

  Fly   393 ----HEGGGGAGGVGGVGGGQVKGRSDPELGMLSS--LEELCKQLVVSVSSQIEDFNESLKICSK 451
                ||..|....|..:...........::..:::  ||.||.|::          |.:|.:.|:
Mouse   415 AAIFHEHTGRLVEVANLACSMSTNEDGIKIVRIAANHLETLCPQII----------NAALALASR 469

  Fly   452 ----LVKS------------FHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTER--L 498
                :||:            .|||....|                   ||..:...:|.:|.  |
Mouse   470 PKSQVVKNTMEMYKRTWEHYIHVLTEAVD-------------------DITSIDDFLAVSESHIL 515

  Fly   499 QVQAKCL-------AINL-RIYGPQVFIAAKIL------------WKYSNSSAANENFESFSDMW 543
            :...||:       |.|| |..|.....||::.            ..|:.....|.||.:.:.:.
Mouse   516 EDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIVAGEMDSYEPGAYTEGVMRNVNFLTSTVIP 580

  Fly   544 KWLT-------------------NEISMIAKKILVSINTTK---------------GDRDADAE- 573
            :::|                   |:...|:|||..:|:..:               .|.:.|.| 
Mouse   581 EFVTQVNVALDALSKNSLTALDDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEDDHEV 645

  Fly   574 ------KCESSSDKLTKSGVPATEDGEMVEYSGLEGKNNGDLNTYQSKWSEDLS--DD--NDILK 628
                  :.|..:|:...:.:|..|..::.|       ...|....:||...::.  ||  |||:.
Mouse   646 RSHTSIQTEGKTDRAKMTQLPEAEKEKIAE-------QVADFKKVKSKLDAEIEIWDDTSNDIIV 703

  Fly   629 RAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNI 693
            .||.|..:...|..||:|.|.|:.|.|:...|:..:|..:|:..:.|..:.|.|....|:|||..
Mouse   704 LAKKMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPPCKQDLLAY 768

  Fly   694 LDRVPTFVQAL----QFTVKDHTVGKAATFVKVDHV---IRETKNLMNVINKVVSKCFECATK 749
            |:::..:...|    |...:...:|.......:|.|   |:..|||||.:.:.|...:..:||
Mouse   769 LEQIKFYSHQLKICSQVKAEIQNLGGELIVSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTK 831

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 177/838 (21%)
Ctnna3NP_001157848.1 Vinculin 83..856 CDD:279395 176/834 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.