DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and hmp-1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001122991.1 Gene:hmp-1 WormBaseID:WBGene00001978 Length:930 Species:Caenorhabditis elegans

Alignment Length:895 Identity:158/896 (18%)
Similarity:284/896 (32%) Gaps:276/896 (31%)


  Fly    35 LNIAVERFITIGEI------IAEEN---IDIKGDMYEAAKEARDAGKSIERLCDISPLSGMELRH 90
            |:.||..|:..|..      ||..:   ||:   ::||....:|.|:       :...:|.:...
 Worm    54 LDAAVANFLQTGSFAISKCPIANSDPRAIDL---LHEALGAVQDTGQ-------VMIQTGRDFVR 108

  Fly    91 HIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFS 155
            .............:.|:||::|.:.|:|.|.|.||.::.......|:..::.......:....::
 Worm   109 DSTSTNKRAIATNSGRNLLTAVAKFLILADSIDVKVIVDKVDEVRETAHQMIEADTKIKVDDLYN 173

  Fly   156 VFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDT 220
            :..:::.||............:..:|..:.:||..|.::..:|.||::..:.|.:....:.|||.
 Worm   174 LLISQIEELDITVRRRAIDLVKPNQRDDLLAARSALRQTAPLLYTSTRTFVRHPEHEEARRNRDY 238

  Fly   221 VFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYE 285
            ...::..|::.:..|:..                                    ::.|...|.|.
 Worm   239 TADEMHSALNALESVLNG------------------------------------QQPKVTFSEYG 267

  Fly   286 GSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHLSSESLDLREELSLAFEKLF 350
            ..|:..|..|.:.:.::                   ::..::|:...      |.:|....|::.
 Worm   268 RIGDLINEIDTFQNRIE-------------------IDPAHYRRGTD------RPDLEGHCERIV 307

  Fly   351 EKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGGGGAGGVGGVGGGQVKGRSD 415
            ..:....|:.....|.::.|::.|:|.:......|....|..               |:.....|
 Worm   308 SGSASIADAESTRENRKQKIVAECNNLRQALQELLTEYEKST---------------GRRDDNDD 357

  Fly   416 PELGMLSSLEELCKQL--------VVSVSSQIEDFNESLKICSKLVKSFHVLATNYDIDNLNQRS 472
            ..|| ::.:.:..|.|        |..:|....|....|.:..:..|..|...|.|       ||
 Worm   358 IPLG-IAEVHKRTKDLRRHLRRAIVDHISDAFLDTRTPLILLIEAAKEGHEENTRY-------RS 414

  Fly   473 SKFHDCCDHIFDICKL-LQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENF 536
            ..|.:..:.|..:.:| .|..:..|.:.| .:..|..|....|||..||.:|.....|..|.||.
 Worm   415 KMFQEHANEIVSVARLSCQLSSDVESVSV-IQHTAAQLEKLAPQVAQAAILLCHQPTSKTAQENM 478

  Fly   537 ESFSDMW----KWLTNEISMI-----------------AKKILVSINTTKGDRDADAEKCE---- 576
            |::.:.|    :.||..:..|                 .::.:..|.......|.:|..||    
 Worm   479 ETYKNAWFDKVRLLTTALDNITTLDDFLAVSEAHIVEDCERGIKGITANASTPDENAANCETVDC 543

  Fly   577 -------------------------SSSDKLTKSGV----------------------------- 587
                                     |...:..|..|                             
 Worm   544 AAGSIRGRALRVCDVVDAEMDFLQNSEYTETVKQAVRILKTQRVDQFAERASALANRQEAHGLTW 608

  Fly   588 -PATEDGEMVEY----------------------------SGLE------GKNNGDLNTYQS--- 614
             |.|::.||.|:                            |.:|      |..|.|.|...|   
 Worm   609 DPKTKEEEMNEFINACTLVHDAVKDIRHALLMNRSMNDVDSDVEYEADGVGAANADANRTISEQE 673

  Fly   615 ------------------------------------KWSEDLSDDNDILKRAKNMSAMAFLMYQF 643
                                                ||.|   ..|||:..|.||..:...|.:|
 Worm   674 NQQNLMRRLPEEEKKKIQAQIDIFKVTQTRFEREVAKWDE---TGNDIISLANNMCKIMMSMTEF 735

  Fly   644 TKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTV 708
            |:|.|.|:||.|:...|:..:...::|..:.|....:...|..|||||..|.::..:.|.|....
 Worm   736 TRGCGPLKTTMDVIRAAQEISLNGSKLNALARQIGEESADSQTKKDLLAYLSQITLYCQQLNICS 800

  Fly   709 K---DHT-VGKAATFVKVD---HVIRETKNLMNVINKVVSKCFECATKYK 751
            |   |.| ||.......:|   .:|:..:||:..:.:.|...:..:||::
 Worm   801 KVKADVTQVGNELVVSALDSAMSLIQTARNLLTAVVQTVKAAYIASTKFR 850

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 151/873 (17%)
hmp-1NP_001122991.1 Vinculin 77..869 CDD:279395 151/873 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.