DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and deb-1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001293743.1 Gene:deb-1 WormBaseID:WBGene00000942 Length:1090 Species:Caenorhabditis elegans

Alignment Length:1046 Identity:167/1047 (16%)
Similarity:317/1047 (30%) Gaps:395/1047 (38%)


  Fly    20 DNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENID--IKGDMYEAAKEARDAGKSIERLCDISP 82
            |...:....|.:| :::.||...|.:|....:.:.|  ::.||..|.:....:.|.:|.      
 Worm   112 DGNAMPDLTGPVG-MVSRAVGNLIQVGYDTCDHSDDRILQQDMPPALQRVEGSSKLLEE------ 169

  Fly    83 LSGMELRHHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESL---EKLESV 144
             |...|:|....:.....:|..||.:|...:.:||..|...|:|::...::|::.:   |.:||:
 Worm   170 -SSYSLKHDPYSVPARKKLIDGARGILQGTSALLLCFDESEVRKIIRVCRKANDYVAVSEVIESM 233

  Fly   145 MNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSL--- 206
            .:..:||                                         |.|:.:|....|.:   
 Worm   234 ADLQQFV-----------------------------------------KDISPVLHDVTNDVNLR 257

  Fly   207 -------IHSDCVI-----VKENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQA-----S 254
                   :|.:.:|     :|.....:.|.::.:::|              ..|..:|.     :
 Worm   258 QQELTHQVHREILIRCMDSIKVIAPILICSMKTSIEL--------------GTPHPRQGHAEAIA 308

  Fly   255 NPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNS------DAYFSFLDDDL-WKSEKNL 312
            |.|:.::.:...:..|:.:::    ..:|.|...:.:|.:      .|..|.|...| |.::.:.
 Worm   309 NRNFMSQRMTEEMNEIIRVLQ----LTTYDEDEWDADNVTVMRKALSAAKSLLTAALDWLADPHA 369

  Fly   313 PSAAGGGRMVNN-TNFRKHLSSESLDLREELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDN 376
            .|.|.|.:.:.. ..:...:|:.:|.  |:.......:|| ...|||.   ..|.|.|.....:|
 Worm   370 RSGAVGEKAIRRICEYADRISARALP--EDAQSIKRSIFE-ITSFTDE---LCNLRNNGQPDREN 428

  Fly   377 CKLEFDLYLNTIMKDQHEGG------------GGAGGV---------------------GGVG-- 406
            ...:....|..::..|:..|            |||...                     ||:|  
 Worm   429 LAAQTARRLKDLVGSQNSSGLMGDALQNAQRHGGANPAHTAAGRLEQALRWLDNPGLDDGGLGLQ 493

  Fly   407 --------GGQVKGRSDPE-----LGMLSSLEELCKQLV-------------------------- 432
                    ..::..|.:|:     ||:.|.::.|..||.                          
 Worm   494 ALRLLTADARKLADRLNPQDRNRLLGLCSDIDRLAAQLADLERRGLGNSPEAHQIRNQLKNALRD 558

  Fly   433 -------VSVSSQIEDFNESLKICSKLVKSFHVLATNYDID---NLNQRSSKFHDCCDHIFDICK 487
                   |.....::||.:......:.|::.|  |..||.:   |...:|.:..|....:....:
 Worm   559 LGDFMRRVLTDRVVDDFADITTPLKQFVEAVH--ADPYDPNREQNFVDKSQRLTDHSQSMTTTAR 621

  Fly   488 LLQHIAPTERLQVQAKCL--AINLRIYGPQVFIAAKILWKYSNSSAANENF-ESFSD-------- 541
            |:....|::..:.....|  |..:....||:..|.::......|....||. :.::|        
 Worm   622 LVASCGPSKSKKTVEAILDTAEKVEQLTPQLVNAGRVRLHNPGSEQHFENIHKQYADALHRLRSH 686

  Fly   542 -----------------MWKW---------------LTNEISMIAK---KILVSINTTKGDRDAD 571
                             |.::               |.|..|.||:   ::|:   |.:.:.|..
 Worm   687 VDDAIDTGEFVRASETAMRRYTNHCEGAINGADAHGLVNNSSQIARLGNRVLM---TAQNEADNS 748

  Fly   572 AE-----KCESSSDKLTKSGVPATEDGEMV------EYS--GLEGKN------------------ 605
            .|     :..:::|:|..:..|...:.:.:      :|:  ...|.|                  
 Worm   749 EEPSFVSRVRNAADQLHNAIPPMVNNAKQIAQNPHDQYAAQNWRGTNDHLLNSVRAVGDAITGVP 813

  Fly   606 --NGDLNTYQSKWS-----------------------------------EDL------------- 620
              ||..::||...|                                   ||:             
 Worm   814 MSNGRHSSYQESISRASPYNPPPPSSQVIRSVNASPPTAPIIHNKMIIREDIPAPPRPPPPVELS 878

  Fly   621 -------------------------------------------------SDDNDILKRAKNMSAM 636
                                                             |.:|||:..||.|:.:
 Worm   879 PPPRPPPPPEYDEEEETRAFWERYPLPQASHQPMLAAAHNLHNELKQWSSQENDIVAAAKRMAIL 943

  Fly   637 AFLMYQFTKGNGSLRTTQDLFTQAEYFA---EEANRLYKVLRHFSYQVPASDNKKDLLNILDRVP 698
            ...:.|..:|.|.  |.:||...::..|   ||..||...|......:..   :..||.:.:|:|
 Worm   944 MARLSQLVRGEGG--TKKDLINCSKAIADSSEEVTRLAVQLARLCTDIKM---RTALLQVSERIP 1003

  Fly   699 TFVQALQF--TVKDHTVGKAATF--------------VKVDHVIRETKNLMNVINKVVSKCFECA 747
            |....|:.  |||...:|.|...              ..:..::...:|||..:..||......:
 Worm  1004 TIATQLKVLSTVKATMLGSANVIGPYGQPVEGSEEDDEAMQQLVHNAQNLMQSVKDVVRAAEAAS 1068

  Fly   748 TKYKLN 753
            .|.:.|
 Worm  1069 IKIRTN 1074

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 160/1015 (16%)
deb-1NP_001293743.1 Vinculin 143..1089 CDD:279395 160/1015 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.