DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and ctn-1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_491008.3 Gene:ctn-1 WormBaseID:WBGene00000832 Length:820 Species:Caenorhabditis elegans

Alignment Length:779 Identity:268/780 (34%)
Similarity:398/780 (51%) Gaps:124/780 (16%)


  Fly    21 NEQIMSTFGNIGHLLNIAVERFITIGEIIAEENIDIKGDMYEAAKEARDAGKSIERL---CDISP 82
            :|:.|.....||..:..|:|||:.:||.||:||.||:.:||:|..|||.||.|:..|   |:..|
 Worm    69 SERAMRAALKIGSAVEAAIERFVCVGETIADENADIQPEMYDACTEARLAGASMANLSCACNDDP 133

  Fly    83 LSGMELRHHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNF 147
            .|          :.|...::.|:|.|||||||:|||.|.::||::|.|:.:.:.||.:|||..:|
 Worm   134 NS----------VVDKAVLVRASRQLLSSVTRVLLLADRVLVKQVLRAEDKIAFSLSRLESTRSF 188

  Fly   148 TEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCV 212
            .:||:.|:|||.||:|||:.:|..::..|.|:|:|||..||..||:...:|||:||..|.|.||.
 Worm   189 NDFVKVFAVFGGEMVELAHRSGDRQHDLKSEKRKAQMSIARTSLERLTMLLLTASKTYLRHPDCD 253

  Fly   213 IVKENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNP---------NYENESIYTTIK 268
            ...:.||.||.|::.:::||...|.|.|..|.|....:.:...|         |       ..||
 Worm   254 SALQCRDGVFYQMKLSLELIAICVCDGILTTEKSRYIQDEPDMPIDIALQLTAN-------AAIK 311

  Fly   269 RIVNLIKRYKYQMSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHLSS 333
            ::..:::..:  |:...|:|                                             
 Worm   312 QLTEMLEMIR--MTVRVGAG--------------------------------------------- 329

  Fly   334 ESLDLREELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGGGG 398
                :||.:..|.:.|.:...|||||.|..|:.|:.||.:.:.|:.|.   .|.|..|::|....
 Worm   330 ----VRERIVSALDALCQLTQDFTDSAYTPHHQREQILDFLEECRFEM---TNLIQPDENEQLAA 387

  Fly   399 AGGVGGVGGGQVKGRSDPELGMLS-SLEELCKQLVVSVSSQIEDF---NESLKICSKLVKSFHVL 459
            :|             .:..:..|: .|::|.|||.:....||.:.   ||.    ..|:.|....
 Worm   388 SG-------------LEVTVERLNRRLKDLSKQLQIVAMEQISEVLRANED----QVLLSSMKAC 435

  Fly   460 ATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILW 524
            |.:.|||.:.:...||.:..||:.::|:||.||:.|:.|.|....:..|:|...|...:|.:.|.
 Worm   436 AVSGDIDGVEKYMHKFREHADHMQEVCRLLHHISITDALHVHTGHVERNMRALAPLTILAGRTLC 500

  Fly   525 KYSNSSAANENFESFSDMWKWLTNEISMIAKKILVSINTTKGDRDADAEKCESSSDKLTKSGVPA 589
            .:.:|..|.||.|.|.|.|....|::|.:||:..|:.|.            ..:::|.....:|.
 Worm   501 VHPSSRIARENLEVFCDTWGQAVNDLSRVAKESDVAANG------------RVAAEKQAYMSLPR 553

  Fly   590 TEDGEMVEYSGLEGK-NNGDLNTYQSKWSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTT 653
            ..|.:.:...|||.| ...:::....||.|  ..:|||:||||.||:||:.||.||:|:|.|:||
 Worm   554 PGDQQKMAKVGLEMKLLTSEVDAEAEKWDE--YAENDIVKRAKAMSSMAYNMYLFTRGDGPLKTT 616

  Fly   654 QDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVKDHTVGKAAT 718
            .|||||||:|||:||::|:.:|.|||:||.|..|.||..||:|:|...|.||..||..||||.||
 Worm   617 HDLFTQAEFFAEQANQMYRTVREFSYEVPGSAEKSDLSAILERIPLHCQQLQVMVKSPTVGKTAT 681

  Fly   719 FVKVDHVIRETKNLMNVINKVVSKCFECATKYKLNLTGITGGLTSERSNENMAGGMCDSKGTTS 782
            |.|||.||:|||||||.|.|:|:..|.|||||::...|  |.:......:.:|.   |:|..||
 Worm   682 FGKVDSVIQETKNLMNEIAKLVTASFVCATKYEIEFRG--GSVNGRTGADGLAP---DTKHPTS 740

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 249/720 (35%)
ctn-1NP_491008.3 Vinculin 100..713 CDD:279395 248/715 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80370863
eggNOG 1 0.900 E1_KOG3681
Hieranoid 1 1.000
Homologene 1 1.000 H2815
Inparanoid 1 1.050 423 1.000 Inparanoid score I985
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D127258at33208
OrthoFinder 1 1.000 FOG0006446
OrthoInspector 1 1.000 T475357
orthoMCL 1 0.900 OOG5_133957
Panther 1 1.100 LDO PTHR46342
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5795
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.