DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and CTNNA2

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001269526.1 Gene:CTNNA2 HGNCID:2510 Length:953 Species:Homo sapiens

Alignment Length:917 Identity:195/918 (21%)
Similarity:354/918 (39%) Gaps:256/918 (28%)


  Fly    33 HLLNIAVER----FITIGEIIAEENIDIKGDMYEAAKEARDAGKSI----ERLCDISPLSGMELR 89
            |:|..:||:    |:..||.||:|:.|:|.::..|.::.|..|:::    ....| .|.|.::  
Human    58 HVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFAD-DPCSSVK-- 119

  Fly    90 HHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAF 154
                    .|.::.|||:|||:|||:|:|.|:..|.:||:..|...|:||.:::..|..:....|
Human   120 --------RGTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRF 176

  Fly   155 SVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRD 219
            ..||.||::|.|:....:...|:...|.:|.:||..|:|:..:|.|:|:..|.|.|....:.|||
Human   177 KEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRD 241

  Fly   220 TVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQ---- 280
            .||.|::.|:        ..|.:.|       ||::|..|.:. :|.|..:...:..:..:    
Human   242 YVFKQVQEAI--------AGISNAA-------QATSPTDEAKG-HTGIGELAAALNEFDNKIILD 290

  Fly   281 -MSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNF-----RKHLSSESLDLR 339
             |::          |:|.|.      ...|:.|.|...|..::.:::.     |:.:.:|...:|
Human   291 PMTF----------SEARFR------PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVR 339

  Fly   340 --------------------EELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLY 384
                                :.|::|.:|:.:|..|      :....||.::.:..:..||.::.
Human   340 QALQDLLSEYMNNTGRKEKGDPLNIAIDKMTKKTRD------LRRQLRKAVMDHISDSFLETNVP 398

  Fly   385 LNTIMKDQHEGGGGAGGVGGVGGGQVK---------------------GRSDPELGM------LS 422
            |..:::....|          ...:||                     ..|:.|.|:      .:
Human   399 LLVLIEAAKSG----------NEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAAT 453

  Fly   423 SLEELCKQLV------------------------------------VSVSSQIEDF-----NESL 446
            .::.||.|::                                    |...:.::||     |..|
Human   454 QIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHIL 518

  Fly   447 KICSKLVKSFHVLATNYDIDNLNQRSSKFHD--------------------CCDHIFDICKLL-Q 490
            :..:|.|    :.....|:|.|::.:.....                    ..:.:.:..||| :
Human   519 EDVNKCV----IALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSE 579

  Fly   491 HIAP--TERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMWKWLTNEISMI 553
            .:.|  .|:::|..:.|:.|:    ||.|               .||  .|.|..:.:.:.:..|
Human   580 TVMPRFAEQVEVAIEALSANV----PQPF---------------EEN--EFIDASRLVYDGVRDI 623

  Fly   554 AKKILVSINTTKGDRDADAEK----------CESSSDKL--------TKSGVPATEDGEMVEYSG 600
            .|.:|:.....:.:.|:|.|:          .::..|:|        ..:.:|..|..::.|...
Human   624 RKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVE 688

  Fly   601 LEGKNNGDLNTYQSKWSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAE 665
            :..:....|:...:||.:   ..|||:..||.|..:...|..||:|.|.|:.|.|:...|:..||
Human   689 IFHQEKSKLDAEVAKWDD---SGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAE 750

  Fly   666 EANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVKDHTVGKAATFVKVDHVIRETK 730
            ..:|:.|:.|..:.|.|.|..|:|||..|.|:..:...|....|               |..|.:
Human   751 AGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLNICSK---------------VKAEVQ 800

  Fly   731 NL---MNVINKVVSKCFECATKYKLNLTGITGGLTSERSNE--NMAGGMCDSKGTTSSSDIPXHY 790
            ||   :.|....|...|  .|.|:::...|.||..|:.|..  ..|.|.....|::.||.:....
Human   801 NLGGELIVSGTGVQSTF--TTFYEVDCDVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSAT 863

  Fly   791 GMARRAK 797
            .:.:.||
Human   864 SLIQAAK 870

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 174/849 (20%)
CTNNA2NP_001269526.1 Vinculin 81..914 CDD:279395 186/895 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.