DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and CTNNA1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001310911.1 Gene:CTNNA1 HGNCID:2509 Length:906 Species:Homo sapiens

Alignment Length:946 Identity:195/947 (21%)
Similarity:330/947 (35%) Gaps:295/947 (31%)


  Fly    33 HLLNIAVER----FITIGEIIAEENIDIKGDMYEAAKEARDAGKSIE----RLCDISPLSGMELR 89
            |:|..:||:    |:..|:.||:|:..:|.::..|.::.|..|..::    ...| .|.|.::  
Human    59 HVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKAAAGEFAD-DPCSSVK-- 120

  Fly    90 HHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAF 154
                    .|.::.|||:|||:|||:|:|.|:..|.|||...|...:.:.||.:..|..:....:
Human   121 --------RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQY 177

  Fly   155 SVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRD 219
            .....|:.:|..:....:...|:...|.||.:||.||:|::.||.|:|:..|.|.|....|.|||
Human   178 KALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRD 242

  Fly   220 TVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYY 284
            .::.|:::|:..|....:.:..|.|                                     |.:
Human   243 LIYKQLQQAVTGISNAAQATASDDA-------------------------------------SQH 270

  Fly   285 EGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHLSSESLDLREE-----LSL 344
            :|.|                            ||.......||.|.:..:.|...||     |..
Human   271 QGGG----------------------------GGELAYALNNFDKQIIVDPLSFSEERFRPSLEE 307

  Fly   345 AFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGGGGAGGVGGVGGGQ 409
            ..|.:...|....||.....:.|:.|::.|:..:......|:..|       |.||.        
Human   308 RLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYM-------GNAGR-------- 357

  Fly   410 VKGRSDPELGMLSSLEELCK-------QLVVSVSSQIED-FNESLKICSKLVKSFHVLATNYDID 466
             |.|||   .:.|:::::.|       ||..:|...:.| |.|:......|:::    |.|.:..
Human   358 -KERSD---ALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEA----AKNGNEK 414

  Fly   467 NLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSA 531
            .:.:.:..|.:..:.:.::..|...|:..|......:..|..|....|||..||..|.....|..
Human   415 EVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKL 479

  Fly   532 ANENFESFSDMW----KWLT---NEISMIAKKILVSINTTKGD----------RDAD-------- 571
            |.||.:.|.:.|    :.||   ::|:.|...:.||.|....|          :|.|        
Human   480 AQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGA 544

  Fly   572 -------------------------------------------AEKCESSSDKLTKSGVPATEDG 593
                                                       .|:.|::.:.|:.......::.
Human   545 IRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDEN 609

  Fly   594 EMVE-----YSGL-------------EGKNNGDLNT----YQSKWSEDLSDD------------- 623
            |.::     |.|:             |..::.|..|    .:|:.|....||             
Human   610 EFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMA 674

  Fly   624 -----------------------------------NDILKRAKNMSAMAFLMYQFTKGNGSLRTT 653
                                               |||:..||.|..:...|..||:|.|.|:.|
Human   675 QLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNT 739

  Fly   654 QDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVK----DHTVG 714
            .|:.:.|:..||..:|:.|:.|..:...|.|..|:|||..|.|:..:...|....|    ...:|
Human   740 SDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLG 804

  Fly   715 KAATFVKVD---HVIRETKNLMNVINKVVSKCFECATKYK-------LNLTGITGGLTSERSNEN 769
            .......||   .:|:..|||||.:.:.|...:..:|||:       |||..::..:.:      
Human   805 GELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKA------ 863

  Fly   770 MAGGMCDSKGTTSSSDIPXHYGMARRAKGDARRTRV 805
                             |....:.:|.|.|..:|::
Human   864 -----------------PEKKPLVKREKQDETQTKI 882

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 182/872 (21%)
CTNNA1NP_001310911.1 Involved in homodimerization 2..228 52/180 (29%)
Vinculin 82..867 CDD:279395 183/907 (20%)
Interaction with JUP and CTNNB1. {ECO:0000269|PubMed:9152027} 97..148 19/62 (31%)
Interaction with alpha-actinin 325..394 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.