DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and Ctnna1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_033948.1 Gene:Ctnna1 MGIID:88274 Length:906 Species:Mus musculus

Alignment Length:945 Identity:195/946 (21%)
Similarity:329/946 (35%) Gaps:293/946 (31%)


  Fly    33 HLLNIAVER----FITIGEIIAEENIDIKGDMYEAAKEARDAG---KSIERLCDISPLSGMELRH 90
            |:|..:||:    |:..|:.||:|:..:|.::..|.::.|..|   ||........|.|.::   
Mouse    59 HVLAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVK--- 120

  Fly    91 HIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFS 155
                   .|.::.|||:|||:|||:|:|.|:..|.|||...|...:.:.||.:..|..:....:.
Mouse   121 -------RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYK 178

  Fly   156 VFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDT 220
            ....|:.:|..:....:...|:...|.||.:||.||:|::.||.|:|:..|.|.|....|.|||.
Mouse   179 ALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDL 243

  Fly   221 VFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYE 285
            ::.|:::|:..|                                                     
Mouse   244 IYKQLQQAVTGI----------------------------------------------------- 255

  Fly   286 GSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNFRKHLSSESLDLREE-----LSLA 345
                    |:|..:...||..:.:    ..:||.......||.|.:..:.|...||     |...
Mouse   256 --------SNAAQATASDDAAQHQ----GGSGGELAYALNNFDKQIIVDPLSFSEERFRPSLEER 308

  Fly   346 FEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQHEGGGGAGGVGGVGGGQV 410
            .|.:...|....||.....:.|:.|::.|:..:......|:..|       |.||.         
Mouse   309 LESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYM-------GNAGR--------- 357

  Fly   411 KGRSDPELGMLSSLEELCK-------QLVVSVSSQIED-FNESLKICSKLVKSFHVLATNYDIDN 467
            |.|||   .:.|:::::.|       ||..:|...:.| |.|:......|:::    |.|.:...
Mouse   358 KERSD---ALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEA----AKNGNEKE 415

  Fly   468 LNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRIYGPQVFIAAKILWKYSNSSAA 532
            :.:.:..|.:..:.:.::..|...|:..|......:..|..|....|||..||..|.....|..|
Mouse   416 VKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA 480

  Fly   533 NENFESFSDMW----KWLT---NEISMIAKKILVSINTTKGD----------RDAD--------- 571
            .||.:.|.:.|    :.||   ::|:.|...:.||.|....|          :|.|         
Mouse   481 QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAI 545

  Fly   572 ------------------------------------------AEKCESSSDKLTKSGVPATEDGE 594
                                                      .|:.|::.:.|:.......::.|
Mouse   546 RGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENE 610

  Fly   595 MVE-----YSGL-------------EGKNNGDLNT----YQSKWSEDLSDD-------------- 623
            .::     |.|:             |..::.|..|    .:|:.|....||              
Mouse   611 FIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQ 675

  Fly   624 ----------------------------------NDILKRAKNMSAMAFLMYQFTKGNGSLRTTQ 654
                                              |||:..||.|..:...|..||:|.|.|:.|.
Mouse   676 LPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTS 740

  Fly   655 DLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVK----DHTVGK 715
            |:.:.|:..||..:|:.|:.|..:...|.|..|:|||..|.|:..:...|....|    ...:|.
Mouse   741 DVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGG 805

  Fly   716 AATFVKVD---HVIRETKNLMNVINKVVSKCFECATKYK-------LNLTGITGGLTSERSNENM 770
            ......||   .:|:..|||||.:.:.|...:..:|||:       |||..::..:.:       
Mouse   806 ELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKA------- 863

  Fly   771 AGGMCDSKGTTSSSDIPXHYGMARRAKGDARRTRV 805
                            |....:.:|.|.|..:|::
Mouse   864 ----------------PEKKPLVKREKQDETQTKI 882

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 182/871 (21%)
Ctnna1NP_033948.1 Involved in homodimerization. {ECO:0000250} 2..228 53/179 (30%)
Vinculin 82..867 CDD:279395 183/906 (20%)
Interaction with JUP and CTNNB1. {ECO:0000250} 97..148 20/61 (33%)
Interaction with alpha-actinin. {ECO:0000250} 325..394 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.