DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and ctnna1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_002932348.2 Gene:ctnna1 XenbaseID:XB-GENE-479599 Length:903 Species:Xenopus tropicalis

Alignment Length:919 Identity:203/920 (22%)
Similarity:351/920 (38%) Gaps:243/920 (26%)


  Fly    33 HLLNIAVER----FITIGEIIAEENIDIKGDMYEAAKEARDAGKSIE----RLCDISPLSGMELR 89
            |:|..:||:    |:..|:.||:|:..:|.::..|.::.|..|:.:.    ...| .|.|.::  
 Frog    58 HVLAASVEQATQNFLDKGDKIAKESQFLKEELIAAVEDVRKQGEQMRSASGEFAD-DPCSSVK-- 119

  Fly    90 HHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAF 154
                    .|.::.|||:|||:|||:|:|.|:..|.:||...|...|.:.||.:.....:....:
 Frog   120 --------RGNMVRAARALLSAVTRLLILADMADVYRLLVQLKVVEEGIVKLRNAGTEQDLGIQY 176

  Fly   155 SVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRD 219
            .....|:.:|..:|...:...|:...|.||.:||.||:|||.||.|:|:..|.|.|....|.|||
 Frog   177 KALKAEVDKLNVMTAKRQQELKDIGHRDQMAAARGILQKSIPILYTASQACLQHPDVAAFKANRD 241

  Fly   220 TVFCQIRRAMDLIHFVVKDSIFDTAKH----------------------MPFEKQASNPNYEN-- 260
            .::.|:::|:..|....:.:..:...|                      :.|.::...|:.|.  
 Frog   242 LIYKQLQQAVTGISNAAQATSSEETAHQQGGGELAVALNNFDKQIIVDPLGFSEERFRPSLEERL 306

  Fly   261 ESIYTTI--------------KRIV---NLIKR-YKYQMSYYEGSGEGNNNSDAYFSFLDD---- 303
            |||.:..              :|||   |.::: .:..:|.|.|:......|||..|.:|.    
 Frog   307 ESIISGAALMADSSCTRDDRRERIVAECNSVRQALQDLLSEYMGNTGRKERSDALNSAIDKMTRK 371

  Fly   304 --DLWKS--------------EKNLP-----SAAGGGRMVNNTNFRKHLSSESLDLREELSLAFE 347
              ||.:.              |.|:|     .||..|.       .|.:...:...||..:    
 Frog   372 TRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGN-------EKEVKEYAQVFREHAN---- 425

  Fly   348 KLFEKAH---------DFTDSPYISHNHRKNILSYCDNCKL-------------EFDLYLNTIMK 390
            ||.|.|:         :......||..|.:::.....|..|             ..||:     |
 Frog   426 KLIEVANLACSISNNEEGVKLVRISAGHLESMCPQVINAALALAAKPHSKMAQETMDLF-----K 485

  Fly   391 DQHEGGGGAGGVGGVGGGQVKGRSDPELGMLSSLEELCKQLVVSVSSQIEDFNESL--------- 446
            :|.|             .||:..:| .:..::|:::.   |.||.:..:||.|:.:         
 Frog   486 EQWE-------------RQVRVLTD-AVDDITSIDDF---LAVSENHILEDVNKCVIALQEKDVD 533

  Fly   447 -------KICSKLVKSFHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQH-IAPTERLQVQAK 503
                   .|..:..:..||:.:..|    |.....:   .:.:.:..|||.: :.|....||:|.
 Frog   534 GLDRTAGAIRGRAARVIHVVTSEMD----NYEPGVY---TEKVLEATKLLSNTVMPRFTEQVEAA 591

  Fly   504 CLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMWKWLTNEISMIAKKILVSINTTKGDR 568
            ..|::                 ...:...:||  .|.|..:.:.:.|..|.|.:|: |.|.:...
 Frog   592 VEALS-----------------GDTNQTMDEN--EFIDASRLVYDGIRDIRKAVLM-IRTPEELD 636

  Fly   569 DADAE----------KCESSSDKL--------TKSGVPATEDGEMVEYSGLEGKNNGDLNTYQSK 615
            |:|.|          ..::..|:|        ..:.:|..:..::.|......:....|:...||
 Frog   637 DSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSK 701

  Fly   616 WSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQ 680
            |.:   :.|||:..||.|..:...|..||:|.|.|:.|.|:.:.|:..||..:|:.|:.|..:..
 Frog   702 WDD---NGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADH 763

  Fly   681 VPASDNKKDLLNILDRVPTFVQALQFTVK----DHTVGKAATFVKVD---HVIRETKNLMNVINK 738
            .|.|..|:|||..|.|:..:...|....|    ...:|.......||   .:|:..|||||.:.:
 Frog   764 CPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQ 828

  Fly   739 VVSKCFECATKYK-------LNLTGITGGLTSERSNENMAGGMCDSKGTTSSSDIPXHYGMARRA 796
            .|...:..:|||:       |||..::..:.:                       |....:.:|.
 Frog   829 TVKASYVASTKYQKSQGMASLNLPAVSWKMKA-----------------------PEKKPLVKRE 870

  Fly   797 KGDARRTRV 805
            |.|..:|::
 Frog   871 KQDETQTKI 879

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 190/845 (22%)
ctnna1XP_002932348.2 Vinculin 81..864 CDD:279395 191/880 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.