DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and ctnnal1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_012819651.1 Gene:ctnnal1 XenbaseID:XB-GENE-5815188 Length:794 Species:Xenopus tropicalis

Alignment Length:843 Identity:241/844 (29%)
Similarity:396/844 (47%) Gaps:166/844 (20%)


  Fly     4 ITQST--VNNQRFRVRDMDNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENIDIKGDMYEAAKE 66
            ::|.|  :|::.   :...:|:.:.....:||.:|.||.||:.:||.||.||.::|.:|..|..|
 Frog    40 VSQITTLINHKE---KPKKSEKTLQAIQRVGHAVNQAVGRFVAVGETIANENRELKEEMGFACSE 101

  Fly    67 ARDAGKSIERLCDISPLSGMELRHHIEP------LKDYGAIILAARSLLSSVTRILLLVDIIVVK 125
            ||.||::|.:|.|      |.:....:|      ..|...::.|||.||||||::|:|.|.||||
 Frog   102 ARRAGETIAQLTD------MNISERPDPDGCTTIFTDKIGVVKAARLLLSSVTKVLVLADRIVVK 160

  Fly   126 KLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQI 190
            :::.::.:...::|.||.|.:|.|||:.||.||.||:|.|:|||..:|..|.|::||.|.:||.:
 Frog   161 QIIASRNKVLATMEHLEKVSSFQEFVQIFSQFGIEMVEFAHLTGDRQNDLKNEKKRASMAAARAV 225

  Fly   191 LEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRRAMDLIHFVVKDSIFDTAKHMPFEKQASN 255
            |||...:|||:||..|.|.||.....|::.||.::|.|::.:..:|.|               |.
 Frog   226 LEKCTMMLLTASKTCLRHPDCESACFNKEGVFQRMRLALEQVVEIVTD---------------SR 275

  Fly   256 PNYENE----SIYTTIKRIVNLIKRYKYQMSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAA 316
            ||.|.|    ||||.||...|.|              ||          |.|:|:          
 Frog   276 PNGECEIVPISIYTGIKEFKNKI--------------EG----------LRDNLY---------- 306

  Fly   317 GGGRMVNNTNFRKHLSSESLDLREELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEF 381
                         :||      :|.:|...|.:.|...|||||.|.||.:|::||...:..|.|.
 Frog   307 -------------YLS------KENVSTMLEVILEHTEDFTDSAYTSHENREHILELSNQAKKEL 352

  Fly   382 DLYLNTIMKDQHEGGGGAGGVGGVGGGQVKG-RSDPELGML---SSLEELCKQL----VVSVSSQ 438
            :..::..|:.|.:              :.|. ..|.||.:|   ..:.||.::|    .|..:..
 Frog   353 EQLVSVWMQAQAQ--------------KTKDIMEDLELAILKMCQCITELKRELHNAATVLAADL 403

  Fly   439 IEDFNESLKICSKLVKSFHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAK 503
            ::...|.:     ::|:..:..|..:::.:.:.:.|..:..:.:.:.|:||:|::.||.|::...
 Frog   404 LKHHTEHM-----VLKALKIAGTEGNLEAVAEYTCKLTEQKEQLVETCRLLRHVSGTEPLEITCI 463

  Fly   504 CLAINLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMWKWLTNEISMIAKKI----------- 557
            .......:.|||:..||:.|..:..|..|.||.:.|.:.|:...|::|::.::|           
 Frog   464 HAEDTFHVSGPQIVSAAETLALHPTSKIAKENLDVFCEAWESQLNDMSVLLREINDVFEGRRGEK 528

  Fly   558 ----------------------LVSINTTKGDRDADAEKCESSSDKLTKSGV--PATEDGEMVEY 598
                                  |:::|.....|.....:.:.:|:..|...|  ...|.|::.:.
 Frog   529 RAYLSLPRPGATTTGLIDQGIFLITLNIFYHQRGLKKHQTKHNSNLKTLKPVKLDVEEQGKIAKL 593

  Fly   599 SGLEGK-NNGDLNTYQSKWSEDLSDDNDILKRAKNMSAMAFLMYQFTKGNGSLRTTQDLFTQAEY 662
             |||.: .:.|:::...||.:   .:|::::..::||:||:.||.||:|.|.|:||||||.|||.
 Frog   594 -GLEVRLLSSDVDSEAEKWED---QENEVVRNGQSMSSMAYTMYLFTRGEGLLKTTQDLFHQAEV 654

  Fly   663 FAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQFTVKDHTVGKAATFVKVDHVIR 727
            ||....:...||..||.|:...|....||.|...:| ..|.||.|.:....||.|||.|||..|:
 Frog   655 FATAGLKFSSVLHAFSNQLEDDDKPLLLLEIEKLIP-LSQQLQITARTPVQGKTATFTKVDTCIQ 718

  Fly   728 ETKNLMNVINKVVSKCFECATKYKLNLTGITGGLTSERSN--------ENMAGGMCDSKGTTS 782
            ::|.:|.::.:|:..|::...|.|.. .|......|.|.|        ::|.|...::.|..|
 Frog   719 KSKAMMIIVLQVLPICWKLQRKCKTG-NGCFQSSPSWRENCLQNITNEDSMEGRTVEAFGVKS 780

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 218/757 (29%)
ctnnal1XP_012819651.1 Vinculin 87..>520 CDD:279395 152/526 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80382734
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2815
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D127258at33208
OrthoFinder 1 1.000 FOG0006446
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.