DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and vcl

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:XP_017950689.1 Gene:vcl XenbaseID:XB-GENE-5759106 Length:1144 Species:Xenopus tropicalis

Alignment Length:1148 Identity:179/1149 (16%)
Similarity:328/1149 (29%) Gaps:504/1149 (44%)


  Fly    38 AVERFITIGEIIAEENID--IKGDMYEAAKEARDA-GKSIE--RLCDISPLSGMELRHHIEPLKD 97
            ||...:.:|:...:...|  :|.||..|..:..:| .|.::  ::....|.|        .|.:|
 Frog    50 AVSNLVRVGKETVQTTEDQIMKRDMPPAFIKVENACAKLVQAAQMLHADPYS--------VPARD 106

  Fly    98 YGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASESLEKLESVMNFTEFVRAFSVFGTEMI 162
            |  :|..:|.:||..:.:||..|...|:|::...|...|.|...|.|.:..:.|......|..|.
 Frog   107 Y--LIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVESMEDLVTYTKNLGPGMT 169

  Fly   163 ELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTSSKNSLIHSDCVIVKENRDTVFCQIRR 227
            ::|.:....:.....:..|..:.::...::..:.:|:::.|                        
 Frog   170 KMAKMIDERQQELTHQEHRVMLVNSMNTVKDLLPVLISAMK------------------------ 210

  Fly   228 AMDLIHFVVKDSIFDTAKH---MPFEKQASNPNYENESIYTTIKRIVNLIKRYKYQMSYYEGSGE 289
                        ||.|.|:   ...|:...|.|:..|.:...|..|:.::     |::.::....
 Frog   211 ------------IFVTTKNSRSQGIEEALKNRNFTVEKMSAEINEIIRVL-----QLTSWDEDAW 258

  Fly   290 GNNNSDAY---FSFLDDDL-----WKSEKNLPSAAGG--------------GRMVNNTNFRK--- 329
            .:.:::|.   .:.:|..:     |..:.|.|....|              |.:...|. ||   
 Frog   259 ASKDTEAMKRALALIDSKINQAKGWLRDPNAPPGDVGEQAVRQILDEAGKVGELCAGTE-RKDIL 322

  Fly   330 -------HLSSESLDLR--------------EELSLAFEKLFEK----AH--------------- 354
                   .::.:..|||              :::|...:.|..|    ||               
 Frog   323 GICRTLGQMTDQVSDLRARGQGATPIAMQKAQQVSQGLDVLTSKVKNAAHKLEALTNSKQAIGKK 387

  Fly   355 ---------DFTDSPYISHNHR------KNILSYCDNCKLEFDLY------------LNTIMK-- 390
                     |....|....|.|      |.|...|::.|.:.|:.            |..:.:  
 Frog   388 IDAAQSWLADPNGGPEGEENIRTILAEAKKIADLCEDPKDKEDILRSLGEIAALTAKLTDLRRQG 452

  Fly   391 --DQHEGGGGAGGVG---------------------------------------------GVGGG 408
              |.||....|..:.                                             |||..
 Frog   453 KGDSHEARALAKQIATSLQNLQTKVNRAVANSRPVKAAVNMEGKVEQAQRWIDNPSVDDKGVGQA 517

  Fly   409 QVKG----------------RSDPELGMLSSLEELCKQ-------------LVVSVSSQIEDFNE 444
            .::|                |.| .:.....:|:|..|             |..:|::|:::..:
 Frog   518 AIRGLVAEGRRLANSMIGPFRQD-MMAKCDRVEQLAGQLAELALRGEGDTPLAQAVAAQLQEALK 581

  Fly   445 SLKICSKL------------------VKSFHVLATN-YDIDN----LNQRSSKFHDCCDHIFDIC 486
            .||  .|:                  :|...|.||: .|..|    ..:|::.|......:....
 Frog   582 DLK--GKMQEAMTQEVSDVFSDTTTPIKLLAVAATSPSDTPNRDEVFEERATNFESHSARLGATA 644

  Fly   487 KLLQHIAPTERLQVQAKCLAI-NLRIYGPQVFIAAKILWKYSNSSAANENFESFSDMW----KWL 546
            :....:....:..|:....|: :.|...|||..||:||.:...:.||.|:||:..:.|    :.:
 Frog   645 EKAAAVGSANKATVEGIQAAVKSARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKM 709

  Fly   547 T--------------------------------------------------NEISMIAKKILVSI 561
            |                                                  |.|.::||:   .:
 Frog   710 TGLVDEAIDTRSLLDASEEAIKKDIDKCKVAMANMQPQMLVAGATSIARRANRILLVAKR---EM 771

  Fly   562 NTTKGDRDADAEKCESSSDKLTK---------------------------SGV------------ 587
            ..::..:..||.|  ::||:|:|                           ||.            
 Frog   772 ENSEDPKFRDAVK--NASDELSKTISPMVMEAKAVAGNISNPALQKGFLDSGYRILGAVAKVREA 834

  Fly   588 ------------------------------------------PATEDGEMVEYSGLEGKNN---- 606
                                                      |..:|.|..|....|..|.    
 Frog   835 FQPPEPEFPPPPDLDQLRLSDEAAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKVGEVVNQPMMV 899

  Fly   607 --GDLNTYQSKW----------------------------------------SEDLSDD------ 623
              ..|:....||                                        |.|:.||      
 Frog   900 AARQLHDEARKWSSKSPGNSDYPAPQGREAVVSEVEQEQEEEEEEASVEFALSSDIEDDYEPELL 964

  Fly   624 ------------------------------NDILKRAKNMSAMAFLMYQFTK----GNGSLRTTQ 654
                                          |||:..||.   ||.||.:.::    |:|:.|.  
 Frog   965 LVPEGQPVNQPMLAAAQSLHREATKWSSKGNDIIAAAKR---MALLMAEMSRLVRGGSGNKRA-- 1024

  Fly   655 DLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFVQALQF--TVKDHTVGKA- 716
             |...|:..|:.::.:.|:.:..:.|......:.:||.:.:|:||....|:.  |||...:|:. 
 Frog  1025 -LIQCAKDIAKASDEVTKLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTN 1088

  Fly   717 --------ATFVKVDHVIRETKNLMNVINKVVSKCFECATKYK 751
                    ||    :.::...:|||..:.:.|.:....:.|.:
 Frog  1089 ISDEESEQAT----EMLVHNAQNLMQSVKETVREAEAASIKIR 1127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 176/1135 (16%)
vclXP_017950689.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.