DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Catr and ctnnal1

Sequence 1:NP_726389.4 Gene:alpha-Catr FlyBaseID:FBgn0029105 Length:810 Species:Drosophila melanogaster
Sequence 2:NP_001137526.1 Gene:ctnnal1 ZFINID:ZDB-GENE-060503-507 Length:754 Species:Danio rerio

Alignment Length:764 Identity:209/765 (27%)
Similarity:363/765 (47%) Gaps:123/765 (16%)


  Fly     7 STVNNQRFRVRDMDNEQIMSTFGNIGHLLNIAVERFITIGEIIAEENIDIKGDMYEAAKEARDAG 71
            :|:.|.:.:::  ..|:.:.....:|..:::||.||:.:||.||.||.|:|.:|..|..|||.||
Zfish    34 TTLINHKDKLK--KTEKTLRAIQRVGQAVSVAVGRFVAVGEAIAAENEDLKEEMGLACFEARRAG 96

  Fly    72 KSIERLCDISPLSGMELRHHIEPLKDYGAIILAARSLLSSVTRILLLVDIIVVKKLLTAKKRASE 136
            ..|.:|.|:|.|...:.........|...::.|||.||||||::|:|.|.||:|::::::.:...
Zfish    97 TGIAQLTDVSSLEHCDGDGRSTVFSDRTGMVKAARMLLSSVTKVLVLADCIVIKQIISSRNKVLV 161

  Fly   137 SLEKLESVMNFTEFVRAFSVFGTEMIELAYLTGHHRNSFKEERRRAQMFSARQILEKSIAILLTS 201
            :||:||.|..|.|||:.||.||.||:|.|:|||..:|..|:|::||:|.:||.:|||...:|||:
Zfish   162 TLEQLERVSTFQEFVQIFSQFGNEMVEFAHLTGDRQNDLKDEKKRARMAAARAVLEKCTMMLLTA 226

  Fly   202 SKNSLIHSDCVIVKENRDTVFCQIRRAMDLIHFVVKDS-IFDTAKHMPFEKQASNPNYENESIYT 265
            ||..|.|.||...:.|::.||.::|.|::.:..:|.|: ....||.:|.            |||.
Zfish   227 SKTCLRHPDCESARINKEAVFQRMRIALEQVIEIVTDTRSSGEAKALPV------------SIYA 279

  Fly   266 TIKRI---VNLIKRYKYQMSYYEGSGEGNNNSDAYFSFLDDDLWKSEKNLPSAAGGGRMVNNTNF 327
            .||..   |..::...|.:|.                                            
Zfish   280 GIKDFKVKVEALRDSLYGVSC-------------------------------------------- 300

  Fly   328 RKHLSSESLDLREELSLAFEKLFEKAHDFTDSPYISHNHRKNILSYCDNCKLEFDLYLNTIMKDQ 392
                        |.::...|.|.||..|||||.|..|..|:.|:..|...:.|....:||....|
Zfish   301 ------------EAVAAQLEALVEKTEDFTDSAYTRHEQRETIIQLCQITRQETKQLINTWRHAQ 353

  Fly   393 HEGGGGAGGVGGVGGGQVKGR---SDPELGML------SSLEELCKQLVVSVSSQIEDFNESLKI 448
                            .:|.:   .:.||.:|      |.|.:...::.|..::::      ||:
Zfish   354 ----------------SLKAKEATDEMELSILKTCQCVSDLRQELHKVAVGRATEL------LKL 396

  Fly   449 CSK--LVKSFHVLATNYDIDNLNQRSSKFHDCCDHIFDICKLLQHIAPTERLQVQAKCLAINLRI 511
            .|.  ::::......:.:::.:...:|...:..:.:.:.|:||.|::.||.|::.........|:
Zfish   397 HSDHLVLQALKASGGDGNLEAVADYASTLTEHNEQLVETCRLLCHVSGTEPLEITCIHAEETFRV 461

  Fly   512 YGPQVFIAAKILWKYSNSSAANENFESFSDMWKWLTNEISMIAKKILVSINTTKGDR----DADA 572
            .|||:..||:.|..:..|..|.||.:.|.:.|:....:::::.|:|.......:||:    ....
Zfish   462 IGPQIISAAQTLALHPTSKIAKENLDVFCEAWESQLCDMAILLKEINDVFEGRRGDKKTYLSLPR 526

  Fly   573 EKCESSSDKLTKSGVPATEDGEMVEYSGLE-GKNNGDLNTYQSKWSEDLSDDNDILKRAKNMSAM 636
            ....|::.|..|:.....|:...:...||| .....|:::...:|.|   .|:::::..:.:|:|
Zfish   527 PGKHSANLKTVKAAKLDAEEQTTIAKLGLELCLLTSDVDSEVERWDE---QDHEMVRLCQIISSM 588

  Fly   637 AFLMYQFTKGNGSLRTTQDLFTQAEYFAEEANRLYKVLRHFSYQVPASDNKKDLLNILDRVPTFV 701
            |:.||.||:|.|.|:||.|||.|||..:::..:|..||:..|.|: ..:::..:::..:::.:..
Zfish   589 AYSMYLFTRGEGLLKTTSDLFHQAEVLSDQGLQLCPVLQSLSTQL-LDEDRMLIISETEKLSSAC 652

  Fly   702 QALQFTVKDHTVGKAATFVKVDHVIRETKN-------LMNVINKVVSKC 743
            |.||...|....||:|.|.|||..|:.||.       |:.:.||::.||
Zfish   653 QQLQACAKTPVQGKSAIFQKVDSSIQNTKGILILVVYLLPICNKLIRKC 701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-CatrNP_726389.4 Vinculin 52..755 CDD:279395 197/720 (27%)
ctnnal1NP_001137526.1 Vinculin 77..>510 CDD:279395 142/523 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80386949
eggNOG 1 0.900 E1_KOG3681
Hieranoid 1 1.000
Homologene 1 1.000 H2815
Inparanoid 1 1.050 300 1.000 Inparanoid score I2615
OMA 1 1.010
OrthoDB 1 1.010 D127258at33208
OrthoFinder 1 1.000 FOG0006446
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133957
Panther 1 1.100 LDO PTHR46342
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5795
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.