DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL4 and AT2G20060

Sequence 1:NP_524939.1 Gene:mRpL4 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_565463.1 Gene:AT2G20060 AraportID:AT2G20060 Length:300 Species:Arabidopsis thaliana

Alignment Length:244 Identity:89/245 (36%)
Similarity:128/245 (52%) Gaps:20/245 (8%)


  Fly    43 TRSPLILPQ----DYTD-CLPVSRNTARQAWIENTDAVAERKVGLIELHPDVFAAQPRVDIIQEN 102
            |:..::.|.    .|.| .:||            |:...|.| |.:.|..|||....|.|||...
plant    72 TKKTVLTPDRTIGQYQDLVIPV------------TNFQNEEK-GFMVLAGDVFDVPIRKDIIHNV 123

  Fly   103 VEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGRARHGSLRSPMLKGGGVVHGPRSPTTHFYM 167
            |.||...|......|||.:||.|.|||||.|||.||||||:||.|..:||.|:|||: |.:|...
plant   124 VRWQLAKRQQGTHSTKTLSEVSGTGRKPWNQKGTGRARHGTLRGPQFRGGCVMHGPK-PRSHAIK 187

  Fly   168 LPFYKRVLGLTSTLSVKLAQDDLHIIDNVDIPTGDAEFLKDLIAERNWGPSVLIVDEDHMFPANI 232
            :....|.|||...|:.:.|:..|.:.|::.:||...:.:.:...:......||:| |.......:
plant   188 MNKQVRRLGLKIALTARAAEGKLLVFDDLGLPTHKTKNIVNYYNQMENTKKVLVV-EGGPIDEKL 251

  Fly   233 CQASDDLGYVNLMPTFGLNVYSMLKHDTLVLTVAAVKHLEQRLLYQLNR 281
            ..|:.:|.|||::|:.||||||:|.||||:::..||..:.:|:...:||
plant   252 KLATQNLHYVNIIPSIGLNVYSILLHDTLLMSRDAVNKIVERMHTPINR 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 76/191 (40%)
AT2G20060NP_565463.1 rplD 91..293 CDD:235404 82/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H32286
Inparanoid 1 1.050 136 1.000 Inparanoid score I1769
OMA 1 1.010
OrthoDB 1 1.010 D1592747at2759
OrthoInspector 1 1.000 T193586
orthoMCL 1 0.900 OOG5_127316
Panther 1 1.100 LDO PTHR10746
Phylome 1 0.910 0.722 Consistency score
98.980

Return to query results.
Submit another query.