DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL4 and mrpl4

Sequence 1:NP_524939.1 Gene:mRpL4 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001018572.1 Gene:mrpl4 ZFINID:ZDB-GENE-050522-388 Length:302 Species:Danio rerio

Alignment Length:266 Identity:128/267 (48%)
Similarity:176/267 (66%) Gaps:19/267 (7%)


  Fly    30 VTEAAATVGAPPATRSPLIL---------PQDYTDCLPVSRN---------TARQAWIENTDAVA 76
            ::..:.....||..|.|..|         |...:| |||.|.         |..|.|:|:..:..
Zfish    19 ISSVSGESALPPNLRLPPNLIGVAAEKRPPPSGSD-LPVVRRCEADVPAHLTPAQTWLESLGSRD 82

  Fly    77 ERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGRARH 141
            ..::|:::||||||:...|:||:.....||..::.:|.|:.||||||||||||||.||..|||||
Zfish    83 SDQLGVVDLHPDVFSVPIRLDILHAVEVWQRNFKRISYANVKTRAEVRGGGRKPWQQKRTGRARH 147

  Fly   142 GSLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDNVDIPTGDAEFL 206
            ||:|||:.:|||::||||.||:::||||...||.||...||.|||||.|||:|:::|||.|.::|
Zfish   148 GSIRSPLWRGGGIIHGPRGPTSYYYMLPMKVRVQGLKIALSAKLAQDYLHIVDSLEIPTPDPQYL 212

  Fly   207 KDLIAERNWGPSVLIVDEDHMFPANICQASDDLGYVNLMPTFGLNVYSMLKHDTLVLTVAAVKHL 271
            :||:..|.||.||||||....||.||.:|::||..||::|..||||:|:|||::||||:.|||.|
Zfish   213 QDLVKHRQWGDSVLIVDVGEEFPQNILKATEDLKTVNIIPALGLNVHSLLKHESLVLTLEAVKFL 277

  Fly   272 EQRLLY 277
            |::||:
Zfish   278 EKKLLW 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 110/191 (58%)
mrpl4NP_001018572.1 Ribosomal_L4 89..280 CDD:278970 110/191 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C206995031
eggNOG 1 0.900 E1_COG0088
Hieranoid 1 1.000
Homologene 1 1.000 H32286
Inparanoid 1 1.050 252 1.000 Inparanoid score I3126
OMA 1 1.010
OrthoDB 1 1.010 D1592747at2759
OrthoFinder 1 1.000 FOG0004127
OrthoInspector 1 1.000 T1052853
orthoMCL 1 0.900 OOG5_127316
Panther 1 1.100 LDO PTHR10746
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1141
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.