DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL4 and mrpl4

Sequence 1:NP_524939.1 Gene:mRpL4 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_012808456.1 Gene:mrpl4 XenbaseID:XB-GENE-1001754 Length:302 Species:Xenopus tropicalis

Alignment Length:271 Identity:125/272 (46%)
Similarity:172/272 (63%) Gaps:21/272 (8%)


  Fly    35 ATVGAPPATRSPLILPQDYTD-------------------C-LPV-SRNTARQAWIENTDAVAER 78
            :|:.:..|..|.||||....|                   | :|| |..:.:..|:|:.....::
 Frog    20 STLSSESALPSNLILPPGLKDGPSKTQRPPVDVSQPVIRPCRVPVPSHLSPKPVWLESLRHPDDQ 84

  Fly    79 KVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGRARHGS 143
            .:||:.||||||...||:||:.:.|.||..::.:|.|..||||||||||:||..|||.||||.||
 Frog    85 PLGLVHLHPDVFTVPPRIDILHQVVTWQRNFKRISHAKVKTRAEVRGGGKKPRQQKGSGRARQGS 149

  Fly   144 LRSPMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDNVDIPTGDAEFLKD 208
            :|||:.:||||.||||.||:::||:|...||.||...|:.||||||||:||:::|.|.|.::|.|
 Frog   150 IRSPLWRGGGVAHGPRGPTSYYYMMPMKMRVQGLKIALTAKLAQDDLHVIDSLEISTPDPQYLVD 214

  Fly   209 LIAERNWGPSVLIVDEDHMFPANICQASDDLGYVNLMPTFGLNVYSMLKHDTLVLTVAAVKHLEQ 273
            ||..|.||.||||||.:...|.||..|:.:|..:|::|..||:|:.||||||::||..||..||:
 Frog   215 LIKHRQWGESVLIVDVNENLPENIFNATVNLKKINVIPAIGLSVFGMLKHDTVILTAGAVDFLEE 279

  Fly   274 RLLYQLNRNDA 284
            :||:..:|..|
 Frog   280 KLLWHDSRYTA 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 105/191 (55%)
mrpl4XP_012808456.1 Ribosomal_L4 91..280 CDD:278970 105/189 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C206993853
eggNOG 1 0.900 E1_COG0088
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32286
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1592747at2759
OrthoFinder 1 1.000 FOG0004127
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.