DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL4 and MRPL4

Sequence 1:NP_524939.1 Gene:mRpL4 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_011526347.1 Gene:MRPL4 HGNCID:14276 Length:357 Species:Homo sapiens

Alignment Length:253 Identity:118/254 (46%)
Similarity:159/254 (63%) Gaps:16/254 (6%)


  Fly     8 TSRQVLYPVARTFSRSGNHGNVVTEAAATVGAPPATRSPLILPQDYTDCLPVSRNTARQAWIENT 72
            |..|.|..:|...:|:..:    .|..|:.|.|......:.||      :|..|... |||:|:.
Human    16 TGSQGLSSLAEEAARATEN----PEQVASEGLPEPVLRKVELP------VPTHRRPV-QAWVESL 69

  Fly    73 DAVAERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGG 137
            ....:.:|||.:|||||||..||:||:.:...||..::.:|.|.|||||||||||||||||||.|
Human    70 RGFEQERVGLADLHPDVFATAPRLDILHQVAMWQKNFKRISYAKTKTRAEVRGGGRKPWPQKGTG 134

  Fly   138 RARHGSLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDNVDIPTGD 202
            ||||||:|||:.:||||.||||.||:::||||...|.|||...|:||||||||||:|::::||||
Human   135 RARHGSIRSPLWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLAQDDLHIMDSLELPTGD 199

  Fly   203 AEFLKDLIAERNWGPSVLIVDEDH-MFPANICQASDDLGYVNLMPTFGLNVYSMLKHD 259
            .::|.:|...|.||.|||:||..| ..|.:|.:|:..|...||:|.    |.:..:|:
Human   200 PQYLTELAHYRRWGDSVLLVDLTHEEMPQSIVEATSRLKTFNLIPA----VATRWRHE 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 98/179 (55%)
MRPL4XP_011526347.1 Ribosomal_L4 81..245 CDD:278970 96/164 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C206996062
eggNOG 1 0.900 E1_COG0088
Hieranoid 1 1.000
Homologene 1 1.000 H32286
Inparanoid 1 1.050 261 1.000 Inparanoid score I3062
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1592747at2759
OrthoFinder 1 1.000 FOG0004127
OrthoInspector 1 1.000 T1073543
orthoMCL 1 0.900 OOG5_127316
Panther 1 1.100 LDO PTHR10746
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1141
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.