DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL4 and Mrpl4

Sequence 1:NP_524939.1 Gene:mRpL4 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001102224.1 Gene:Mrpl4 RGDID:1311777 Length:294 Species:Rattus norvegicus

Alignment Length:290 Identity:137/291 (47%)
Similarity:178/291 (61%) Gaps:20/291 (7%)


  Fly     1 MLNNILKTSRQVLYPVARTFSRSGNHGNVVTEAAATVGAP-----PATRSPLILPQDYTDC---L 57
            ||......||..|.|         |...|::..|.....|     |...:.|:.|. ...|   :
  Rat     1 MLRLFQAASRAWLRP---------NGSRVISSLAEDAVRPAEISEPGDSAGLLDPV-LRKCELPI 55

  Fly    58 PVSRNTARQAWIENTDAVAERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAE 122
            |..|... |||:|:.....:.::||.||||||||..||:||:.:...||..::.:|.|.||||||
  Rat    56 PAPRRPV-QAWVESLRGFEQERIGLAELHPDVFATTPRLDILHQVAVWQRNFKRISYAKTKTRAE 119

  Fly   123 VRGGGRKPWPQKGGGRARHGSLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQ 187
            |.|||||||.|||.|||||||:|||:.:||||.||||.||:::||||...|.|||...|:|||.|
  Rat   120 VSGGGRKPWQQKGSGRARHGSIRSPIWRGGGVAHGPRGPTSYYYMLPMKVRALGLKVALTVKLMQ 184

  Fly   188 DDLHIIDNVDIPTGDAEFLKDLIAERNWGPSVLIVDEDH-MFPANICQASDDLGYVNLMPTFGLN 251
            |||||:|::::||.|.::|.:|...|:||.|||:||..| ..|.|:..|:..|...||:|..|||
  Rat   185 DDLHIVDSLELPTADPQYLTELAQYRHWGSSVLLVDLTHEEMPKNVMAATSRLNSFNLIPAVGLN 249

  Fly   252 VYSMLKHDTLVLTVAAVKHLEQRLLYQLNR 281
            |||||||.|||||:.:|..||.:||:|.:|
  Rat   250 VYSMLKHQTLVLTLPSVAFLEDKLLWQDSR 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 111/192 (58%)
Mrpl4NP_001102224.1 Ribosomal_L4 81..272 CDD:278970 111/191 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C206994625
eggNOG 1 0.900 E1_COG0088
Hieranoid 1 1.000
Homologene 1 1.000 H32286
Inparanoid 1 1.050 255 1.000 Inparanoid score I3048
OMA 1 1.010
OrthoDB 1 1.010 D1592747at2759
OrthoFinder 1 1.000 FOG0004127
OrthoInspector 1 1.000 T1087188
orthoMCL 1 0.900 OOG5_127316
Panther 1 1.100 LDO PTHR10746
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.