DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL4 and SPBC2D10.08c

Sequence 1:NP_524939.1 Gene:mRpL4 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_596227.1 Gene:SPBC2D10.08c PomBaseID:SPBC2D10.08c Length:261 Species:Schizosaccharomyces pombe

Alignment Length:200 Identity:52/200 (26%)
Similarity:86/200 (43%) Gaps:12/200 (6%)


  Fly    95 RVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGRARHGSLRSPMLKGGGVVHGPR 159
            |.||:...|.:::.......|.:|.|.|:...|||.:.|||.|.||.|...||:.:||...|||:
pombe    34 RRDILHRAVIYEADNDRQGTASSKRRNEITCSGRKLYRQKGTGHARVGDASSPIRRGGAKSHGPK 98

  Fly   160 SPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDN-VDIPTGDAEFLKDLIAERNWG---PSVL 220
             |......|......|.:...||.:...::|.|::| :::.......|.:::.:...|   ...|
pombe    99 -PRDFSTKLQTQVYNLAMRIALSTRFINNELTILENPINLSQPKTRILLEVLKQHKLGHEYGKAL 162

  Fly   221 IVDEDHMFP------ANICQASDDLGY-VNLMPTFGLNVYSMLKHDTLVLTVAAVKHLEQRLLYQ 278
            .|..|:.|.      .|:..||..||| .:.:|.....|...||...|.:...|:..:.::...:
pombe   163 FVLNDNYFEDESLKNNNLLLASRQLGYHCSFIPVGEFQVRDALKFGKLFIDSEAMSLIVEKFAQR 227

  Fly   279 LNRND 283
            ...:|
pombe   228 NTLSD 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 51/190 (27%)
SPBC2D10.08cNP_596227.1 RplD 28..227 CDD:223166 51/194 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I1983
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004127
OrthoInspector 1 1.000 T1124982
orthoMCL 1 0.900 OOG5_127316
Panther 1 1.100 LDO PTHR10746
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1141
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.