DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL4 and mrpl-4

Sequence 1:NP_524939.1 Gene:mRpL4 FlyBaseID:FBgn0001995 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_505181.1 Gene:mrpl-4 WormBaseID:WBGene00020717 Length:299 Species:Caenorhabditis elegans

Alignment Length:223 Identity:103/224 (46%)
Similarity:148/224 (66%) Gaps:1/224 (0%)


  Fly    66 QAWIENTDAVAERKVGLIELHPDVFAAQPRVDIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKP 130
            |||:.|.|.:.:.|:||::||||:|...||:||:..|:.|||.||.|.|....|:||:.||||||
 Worm    50 QAWVSNLDTIEDEKLGLVDLHPDIFRTSPRIDILHRNLTWQSVYRNVQMTKMLTKAEMPGGGRKP 114

  Fly   131 WPQKGGGRARHGSLRSPMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDN 195
            ||||..|||..||:|||....||..:|.|.|.|.|||||...|:.||...|::|..||||||:|.
 Worm   115 WPQKKTGRAHVGSIRSPQFIRGGFANGVRGPRTWFYMLPDAVRIQGLCVALTLKHTQDDLHIVDK 179

  Fly   196 V-DIPTGDAEFLKDLIAERNWGPSVLIVDEDHMFPANICQASDDLGYVNLMPTFGLNVYSMLKHD 259
            : ::..||.::..||...||:|.|||.||:.......:.:|...|.::|:||.:|||.:|::|:|
 Worm   180 IQNLQNGDPKYWIDLCEARNYGYSVLFVDDCDEISGGLAEAQQALPWLNVMPVYGLNCFSLMKYD 244

  Fly   260 TLVLTVAAVKHLEQRLLYQLNRNDAASK 287
            |:||:.:|::.:|:|||.|::|....:|
 Worm   245 TIVLSRSALERVEERLLTQMHRAGPMNK 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL4NP_524939.1 Ribosomal_L4 83..274 CDD:278970 89/192 (46%)
mrpl-4NP_505181.1 Ribosomal_L4 67..259 CDD:278970 89/192 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C206992180
eggNOG 1 0.900 E1_COG0088
Hieranoid 1 1.000
Homologene 1 1.000 H32286
Inparanoid 1 1.050 217 1.000 Inparanoid score I2281
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1592747at2759
OrthoFinder 1 1.000 FOG0004127
OrthoInspector 1 1.000 T475559
orthoMCL 1 0.900 OOG5_127316
Panther 1 1.100 LDO PTHR10746
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1141
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.