DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CIAPIN1 and Ciapin1

Sequence 1:NP_524938.1 Gene:CIAPIN1 FlyBaseID:FBgn0001977 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001007690.1 Gene:Ciapin1 RGDID:1549737 Length:309 Species:Rattus norvegicus

Alignment Length:284 Identity:110/285 (39%)
Similarity:151/285 (53%) Gaps:59/285 (21%)


  Fly    20 LDKRVEQLKAATG--GDVALENVHRLSFSSYANSSFDLIV------IECAQLTDSYVKLLHMLKP 76
            |.|.|.:::..||  |.|.:||:.:|..|::..||||:|:      .......::...:..:|:|
  Rat    25 LKKLVGRVQGLTGSEGQVFVENITQLLQSAHKESSFDVILSGIVPGSTSLHSPEALADMARILRP 89

  Fly    77 SGKLHLV----------SYIGPAASLLQEIKLSGFINCREDSPDAL------------------- 112
            .|.|.|.          ..|..|:.|...:.|||.:..:|...:||                   
  Rat    90 GGCLFLKEPVETTGVNNDKIKTASKLCSALTLSGLVEIKELQREALSPEEAQSMQEHLGYHSDSL 154

  Fly   113 -----TAEKPGYETGSSARLSFAKKNASAV---------NVWKISGDDEE-----LIDEEELLDE 158
                 |.:||.:|.|||::|....|.:|:|         .:|.:|.:|.|     |||.:||||.
  Rat   155 LSVHVTGKKPNFEVGSSSQLKLLHKKSSSVKPVVDPATAKLWTLSANDMEDDSMDLIDSDELLDP 219

  Fly   159 EDKQKPDPAGLRV--CSTTGKRKACKNCSCGLAEELETEKQSQKATENAKSSCGNCYLGDAFRCS 221
            ||.:|||||.|:.  |....||||||||:||||||||.| ||:..:...||:||||||||||||:
  Rat   220 EDLKKPDPASLKAPSCGEGKKRKACKNCTCGLAEELEKE-QSKAQSSQPKSACGNCYLGDAFRCA 283

  Fly   222 TCPYLGMPAFKPGEKVQLADNLLK 245
            .|||||||||||||:|.|:.:.|:
  Rat   284 NCPYLGMPAFKPGEQVLLSSSNLQ 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CIAPIN1NP_524938.1 CIAPIN1 172..239 CDD:282890 48/67 (72%)
Ciapin1NP_001007690.1 AdoMet_MTases 3..95 CDD:302624 20/70 (29%)
N-terminal SAM-like domain. {ECO:0000255|HAMAP-Rule:MF_03115} 6..172 37/147 (25%)
Linker. {ECO:0000255|HAMAP-Rule:MF_03115} 173..222 17/49 (35%)
Intrinsically disordered. {ECO:0000255|HAMAP-Rule:MF_03115} 223..309 56/87 (64%)
CIAPIN1 233..301 CDD:282890 48/69 (70%)
Fe-S binding site A. {ECO:0000255|HAMAP-Rule:MF_03115} 235..249 9/14 (64%)
Fe-S binding site B. {ECO:0000255|HAMAP-Rule:MF_03115} 271..285 12/14 (86%)
Cx2C motif 1. {ECO:0000255|HAMAP-Rule:MF_03115} 271..274 3/3 (100%)
Cx2C motif 2. {ECO:0000255|HAMAP-Rule:MF_03115} 282..285 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C257829247
eggNOG 1 0.900 E1_COG5636
Hieranoid 1 1.000
Homologene 1 1.000 H10658
Inparanoid 1 1.050 169 1.000 Inparanoid score I3999
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1588798at2759
OrthoFinder 1 1.000 FOG0003731
OrthoInspector 1 1.000 T1087231
orthoMCL 1 0.900 OOG5_128282
Panther 1 1.100 LDO PTHR13273
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.760

Return to query results.
Submit another query.