DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: thg1l and THG

Sequence 1:NP_001007456.1 Gene:thg1l ZFINID:ZDB-GENE-041114-170 Length:269 Species:Danio rerio
Sequence 2:NP_001188815.1 Gene:THG FlyBaseID:FBgn0283659 Length:286 Species:Drosophila melanogaster

Alignment Length:264 Identity:140/265 (53%)
Similarity:186/265 (70%) Gaps:18/265 (7%)


Zfish     1 MAKSKFEYVRNFELDDTCLRNCYIVVRLDGRNLHKFSDQHNFTKPNDDRALGLMSRSACSVMEEL 65
            ||.|:||||::||.||:.|.|.:||:|:||:..||||..|:|.||||:.||.:|:.:|.:||:|.
  Fly     1 MACSRFEYVKSFEQDDSILPNVWIVIRIDGKKFHKFSKTHDFEKPNDENALNVMNAAATAVMQEF 65

Zfish    66 DDITIAYGQSDEFSFVFKRSTNWFKRRASKLMTHVTSQFSSSFVFYWKEYFGEQPLLYPPSFDGR 130
            .||.:|||||||:||||::.|..||||::||:|:|||.||||:|..|.::. ..||.|.|.||||
  Fly    66 RDIVLAYGQSDEYSFVFRKETAAFKRRSAKLLTYVTSLFSSSYVMQWSKWM-NLPLAYAPCFDGR 129

Zfish   131 VVLYPSNRNVRDYLSWRQADCHINNLYNTAFWTLVQKGGLTTTQAEERLNGTLATDKNEILFSEF 195
            ||||||.:|::|||||||||.|:|||||||||.||.:.|||..|||.:|.||.:.||||:||.||
  Fly   130 VVLYPSEQNLKDYLSWRQADVHVNNLYNTAFWKLVLEKGLTNQQAEAKLRGTFSADKNELLFQEF 194

Zfish   196 NINYNNESSVYKKGTTLIWEKVNETTTKQIKRPNEEETEVTVTRTRKKVTSHSCDVIGDQFWDEH 260
            .|||||..::|:|||.|:.::|                 :...::|:.|.....|:|..|||.||
  Fly   195 GINYNNLPAMYRKGTILLRKRV-----------------ILGEKSRQAVVPLHEDLISSQFWKEH 242

Zfish   261 PDIL 264
            .:||
  Fly   243 TEIL 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
thg1lNP_001007456.1 Thg1 2..257 CDD:226508 134/255 (53%)
Thg1 9..135 CDD:282322 71/126 (56%)
Thg1C 138..252 CDD:291110 53/114 (46%)
THGNP_001188815.1 Thg1 2..239 CDD:226508 134/255 (53%)
Thg1 9..134 CDD:282322 71/126 (56%)
Thg1C 137..234 CDD:291110 53/114 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C165996374
eggNOG 1 0.900 E1_COG4021
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5959
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1152974at2759
OrthoFinder 1 1.000 FOG0004530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129044
Panther 1 1.100 LDO PTHR12729
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.