DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-87B and AT3G09960

DIOPT Version :10

Sequence 1:NP_524937.1 Gene:Pp1-87B / 49260 FlyBaseID:FBgn0004103 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_566363.1 Gene:AT3G09960 / 820157 AraportID:AT3G09960 Length:311 Species:Arabidopsis thaliana


Alignment Length:77 Identity:26/77 - (33%)
Similarity:39/77 - (50%) Gaps:10/77 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IC-GDIHGQYYDLLRLF-------EYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY-SE 114
            || |||||....|.:|:       :...| ..:..:|||||.|||.::.:.|..|::...|: .:
plant    10 ICVGDIHGNISKLNKLWLNLQSDIQNSDF-SSALVIFLGDYCDRGPETRKVIDFLISLPEKHPDQ 73

  Fly   115 NFFLLRGNHECA 126
            ....|.|||:.|
plant    74 THVFLAGNHDFA 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-87BNP_524937.1 MPP_PP1_PPKL 6..296 CDD:277359 26/77 (34%)
AT3G09960NP_566363.1 MPP_Rhilphs 6..310 CDD:163664 26/77 (34%)

Return to query results.
Submit another query.