DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mod(mdg4) and BtbVII

Sequence 1:NP_788698.1 Gene:mod(mdg4) FlyBaseID:FBgn0002781 Length:610 Species:Drosophila melanogaster
Sequence 2:NP_647774.2 Gene:BtbVII FlyBaseID:FBgn0263108 Length:907 Species:Drosophila melanogaster

Alignment Length:515 Identity:135/516 (26%)
Similarity:189/516 (37%) Gaps:152/516 (29%)


  Fly     5 EQFSLCWNNFNTNLSAGFHESLCRGDLVDVSLAAEGQIVKAHRLVLSVCSPFFRKMFTQMPSNTH 69
            :||.|.|||...|..:.....|..|.||||:|||||:.::||::|||.||.:|:.:||..|.. |
  Fly     4 QQFCLRWNNHQPNFISVCSSLLHNGTLVDVTLAAEGRQLQAHKIVLSACSSYFQALFTTNPCQ-H 67

  Fly    70 AIVFLNNVSHSALKDLIQFMYCGEVNVKQDALPAFISTAESLQIKGLTD--NDPAPQPPQES--- 129
            .||.|.:|.:..||.::.|||.|||||.|:.||..:.|||.|:||||.:  .|||.....:|   
  Fly    68 PIVILKDVQYDDLKTMVDFMYYGEVNVSQEQLPHILKTAEMLKIKGLAEMPTDPANLTKSDSKSS 132

  Fly   130 ------------------------------------SPPPAAPHVQQQQIPAQRVQRQQPRASAR 158
                                                |...|....||||..||:..:||..    
  Fly   133 TDGTEMVGGAGVGTGAGNSAGSLGAGSGSSVGDSLWSSSEAQQFQQQQQQQAQQQAQQQHH---- 193

  Fly   159 YKIETVDDGLGDEKQSTTQIVIQTTAAPQATIVQQQQPQQAAQQIQSQQLQTGTTTTATLVSTNK 223
                        ..|...|:..|...|      ||||.||.......||.|:|....|   .|:.
  Fly   194 ------------HHQQQQQLQQQQQQA------QQQQQQQQHHHHHHQQQQSGQAQAA---QTHH 237

  Fly   224 RSAQRSSLTPASSSAGV------KRSKTSTS------ANVMDPLDSTTETGA------TTTAQLV 270
            ...:|   ||:..|||.      ||.:.|::      .|..:..:|:.:.|:      .:.||: 
  Fly   238 HQMRR---TPSPLSAGTSPATRRKRLRKSSNNGSGDRNNAEEQHNSSLDAGSGAGNAGLSLAQM- 298

  Fly   271 PQQITVQTSVVSAAE----AKLHQQSPQQVRQEEAEYIDLPMELPTKSEPDYSEDHGDAAGDAEG 331
             .|:|.......|..    |||.::|.....:::.:..||                         
  Fly   299 -NQMTFGAGGGLAGHSLHAAKLLKESASAELEQQPQDSDL------------------------- 337

  Fly   332 TYVEDDTYGDMRYDDSYFTENEDAG--NQTAANTSGGGVTATTSKAVVKQQSQNYSESS------ 388
                ||.:|.:...   .....|.|  |||......||.|.:...|...|.|  :||.|      
  Fly   338 ----DDGHGHLHMQ---IKPEVDIGGVNQTMPLDISGGTTPSEHDAPNSQSS--HSEPSPAHAPH 393

  Fly   389 --------FVDTSGDQGNTE--------AQAATSASATKIPPRKRGRPKTKVEDQTPKPK 432
                    ...:||..|:.|        .........|...|...|..:.:|..:.|:.|
  Fly   394 PPHPPLGAASSSSGGSGSFERSFSIGGVGSVECDPDGTPSSPAVMGTKRNRVLTRQPRVK 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mod(mdg4)NP_788698.1 BTB 22..118 CDD:279045 48/96 (50%)
BTB 33..118 CDD:197585 44/85 (52%)
FLYWCH 452..512 CDD:282369
BtbVIINP_647774.2 BTB 24..117 CDD:279045 48/94 (51%)
BTB 32..117 CDD:197585 44/86 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000318
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23110
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.