DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP79C2

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_176122.2 Gene:CYP79C2 AraportID:AT1G58260 Length:530 Species:Arabidopsis thaliana

Alignment Length:564 Identity:136/565 (24%)
Similarity:228/565 (40%) Gaps:135/565 (24%)


  Fly     3 YTVIWIFCATLLAIL--FGGVRKPK-RFPPGPAWYPIVGSALQV------------------SQL 46
            :|::.|....:||:.  |....||| :.||||..:||||:.||:                  :.:
plant    10 FTLVLISITLVLALARRFSRFMKPKGQLPPGPRGWPIVGNMLQMIINRPAHLWIHRVMEELQTDI 74

  Fly    47 RC-RLGMFCKVIDV----FARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIF 106
            .| |...| .||.|    .||:.:..         ||:|:...:....|.::::.          
plant    75 ACYRFARF-HVITVTSSKIAREVLRE---------KDEVLADRSESYASHLISHG---------- 119

  Fly   107 YRLRTFNSRLGVLLTDGEMWVEQRRFILRHL-------KNFGFAR---SGMMDIVHNEATCLLQD 161
            |:..:|:|.       ||.|...::.:...|       |..|:..   ..::..|:|  .|.|  
plant   120 YKNISFSSY-------GENWKLVKKVMTTKLMSPTTLSKTLGYRNIEADNIVTYVYN--LCQL-- 173

  Fly   162 LKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRY-----EPG--SPE-------ITQLLET 212
                    |..:..|.:.|....|....:..|:.|:|:     |.|  .|:       |...|:.
plant   174 --------GSVRKPINVRDTILTYCHAVMMRMMFGQRHFDEVVENGGLGPKEKEHMDAIYLALDC 230

  Fly   213 FFELFKNIDMVGALFSHFPLLRFIAPNFSGYN---GFVESHRSLY-------TFMSKEIELHRLT 267
            ||..        .|.::.|.||       |:|   ...|...:::       ..:.:.|.|.|..
plant   231 FFSF--------NLTNYIPFLR-------GWNVDKAETEVREAVHIINICNDPIIQERIHLWRKK 280

  Fly   268 -YKNYDEPRDLMDSYLRAQDEGNDEKGM--FSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQ 329
             .|..:|  |.:|..:..:    |::||  |:...:.|.|.::.||..:.|..::.:....::..
plant   281 GGKQMEE--DWLDILITLK----DDQGMHLFTFDEIRAQCKEINLATIDNTMNNVEWTIAEMLNH 339

  Fly   330 PEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYE 394
            |||.|:|..|:..:||.:|:.:.| |.::|.|.:|.:.|:.|:...:.|...|.|..||.|:||.
plant   340 PEILEKATNELDIIVGKDRLVQES-DISQLNYIKACSKESFRLHPANVFMPHHVAREDTTLAGYF 403

  Fly   395 IPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGH--------LKLPE-AFNPFGFGRHRCMG 450
            :||.:.::....|:..||..:.:|.:|.|:||| |||        |..|: .|..||.||..|.|
plant   404 VPKGSQILVSRLGLGRNPKIWDEPNAFKPERYL-DGHVEKSLGVTLMEPDMRFVTFGTGRRSCPG 467

  Fly   451 DLLGRQNLFMFTTTVLQNFKMVAIPGQVPEE-VPLEGATAAVKP 493
            ..:|.....|....::|.|:.....|:...| :..|......||
plant   468 TKIGTSMTIMLLARLIQGFEWTLPIGKSSVELISAESNLFMAKP 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 124/521 (24%)
CYP79C2NP_176122.2 p450 10..529 CDD:299894 136/565 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.