DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71B28

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_172768.1 Gene:CYP71B28 / 837866 AraportID:AT1G13090 Length:490 Species:Arabidopsis thaliana


Alignment Length:481 Identity:116/481 - (24%)
Similarity:203/481 - (42%) Gaps:79/481 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CATLLAILFGGVRKPKRF--PPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FY 71
            |...|.::|....||.::  ||||...||:|:..|..:|..|          .:|.....|| ..
plant     9 CLLPLILIFLKNLKPSKWKLPPGPKKLPIIGNLHQRRELHPR----------NSRNLSEKYGPIV 63

  Fly    72 GLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR--- 131
            .|:.|...||:..:.:|..|::...|::  .||:.:..|..::|.:.......||.|...|:   
plant    64 FLRYGFVPVVVISSKEAAEEVLKTHDLECCSRPETVGTRAISYNFKDIGFAPYGEDWRTMRKLSV 128

  Fly   132 ---FILRHLKNFGFARSGMMDIVHNEATCL--LQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLW 191
               |..:.|::|.:.|....|:      |:  |.||       ..:::.:.: :.|...::.::.
plant   129 VELFSSKKLQSFRYIREEENDL------CVKKLSDL-------ASRRSLVNL-EKTLFTLVGSIV 179

  Fly   192 CM----LSGRRYE-PGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNG------ 245
            |.    ::.|..| .....|..|:....::.:|     ::||.|         |.|..|      
plant   180 CRIGFGINLRECEFVDEDSIDDLVHKSEDVIRN-----SIFSDF---------FPGLMGRLIEWI 230

  Fly   246 FVESHR--SLY----TFMSKEIELHRLTYKNYDEPRDLMDSYLRAQD-EGNDEKGMFSDQSLLAI 303
            |.|..|  .||    ||....::.|....:...:..|:|...::.|: ||:..|  |:...|..:
plant   231 FSERKRLNRLYSEVDTFFQNILDDHLKPGRESSDIIDVMIDMMKKQEKEGDSFK--FTTDHLKGM 293

  Fly   304 CLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVG--LERIPEWSRDRTKLPYCEAIT 366
            ..|:||||..|::.:|.:....|:..|.:.::...||:..:|  .|||.|  .|..:|.|.:.:.
plant   294 ISDIFLAGVGTSSTTLIWAMTELIRNPRVMKKVQDEIRTTLGDKKERITE--EDLNQLHYFKLMV 356

  Fly   367 LEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGH 431
            .|..|:.......:|...:...::.||:||..|.::.....:..:|..:.:|:.|||||:| |..
plant   357 KEIFRLHPAAPLLLPRETLSHVKIQGYDIPAKTQIMINAYAIARDPKLWTNPDEFNPDRFL-DSS 420

  Fly   432 LK---LPEAFNPFGFGRHRCMGDLLG 454
            :.   |.....|||.||..|.|..:|
plant   421 IDYRGLNFELLPFGSGRRICPGMTMG 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 111/461 (24%)
CYP71B28NP_172768.1 CYP71-like 58..474 CDD:410695 100/422 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.