DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71B2

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_172767.1 Gene:CYP71B2 AraportID:AT1G13080 Length:502 Species:Arabidopsis thaliana

Alignment Length:548 Identity:133/549 (24%)
Similarity:222/549 (40%) Gaps:107/549 (19%)


  Fly     5 VIWIFCATLLAI---LFGGVRKPKRF--PPGPAWYPIVGSALQVSQL--RCRLGMFCKVIDVFAR 62
            ::..|..:||.|   :|....|..:|  ||.|:..||:|:...::.|  ||...:..|       
plant     4 LLCFFLVSLLTIVSSIFLKQNKTSKFNLPPSPSSLPIIGNLHHLAGLPHRCFHKLSIK------- 61

  Fly    63 QYVNPYGFYG----LKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNS-RLGVLL 120
                    ||    |::|...||:..:::|...::...|::  .||       :|..| :|....
plant    62 --------YGPLVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRP-------KTVGSGKLSYGF 111

  Fly   121 TD------GEMWVEQRR------FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQ 173
            .|      ||.|.|.|:      |..:.:::|.:.|...:|.|           ..||.:|..||
plant   112 KDITFAPYGEYWREVRKLAVIELFSSKKVQSFRYIREEEVDFV-----------VKKVSESALKQ 165

  Fly   174 TRIEM----HDLTSVYV--------LNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGAL 226
            :.:::    ..||:..:        .|....::...|.|....|..:.|.||            .
plant   166 SPVDLSKTFFSLTASIICRVALGQNFNESGFVIDQDRIEELVTESAEALGTF------------T 218

  Fly   227 FSHF---PLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLT--YKNYDEPRDLMDSYLRAQD 286
            ||.|   .|.||:...|..:....:..:.|..|....|:.|...  .||.|....::|...:.:|
plant   219 FSDFFPGGLGRFVDWLFQRHKKINKVFKELDAFYQHVIDDHLKPEGRKNQDIVTLILDMIDKQED 283

  Fly   287 EGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGL--ERI 349
            ..:.:..|   .:|.||.:|:||||.:|:..::.:....|:..|.:.::|.:.|:..:||  |||
plant   284 SDSFKLNM---DNLKAIVMDVFLAGIDTSAVTMIWAMTELIRNPRVMKKAQESIRTTLGLKKERI 345

  Fly   350 PEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVD 414
            .|  .|..|:.|...|..|..|:.....|.:|...:...::.||:||..|.:......:..:|..
plant   346 TE--EDLGKVEYLNHILKETFRLHPALPFVVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKR 408

  Fly   415 FPDPESFNPDRYL-----FDG-HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVA 473
            :.|||.|||:|:.     |.| |..|    .|||.||..|.|..:...::.:....:|..|....
plant   409 WNDPEEFNPERFANSSVDFRGQHFDL----LPFGSGRRICPGMPMAIASVELALMNLLYYFDWSM 469

  Fly   474 IPGQVPEEVPLE--GATAAVKPYDIMLV 499
            ..|...|::.:|  |..:.||...:.||
plant   470 PDGTKGEDIDMEEAGNISIVKKIPLQLV 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 119/498 (24%)
CYP71B2NP_172767.1 p450 5..500 CDD:299894 133/548 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.