DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71A18

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana

Alignment Length:528 Identity:114/529 (22%)
Similarity:195/529 (37%) Gaps:142/529 (27%)


  Fly     1 MFYTVIWIFC-ATLLAIL-----FGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDV 59
            |..|::...| .|||.:|     .....|....||.|...|::|:..|:|               
plant     1 MEMTLMVSLCLTTLLTLLLLKKFLKRTAKKVNLPPSPWRIPVIGNLHQLS--------------- 50

  Fly    60 FARQYVNPYGF-------YG----LKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRT 111
                 ::|:..       ||    |..|:..:::..:::|..|::...|:.  .||.........
plant    51 -----LHPHRSLHSLSLRYGPLMLLHFGRVPILVVSSSEAAHEILKTHDLKFANRPKSKAVHGLM 110

  Fly   112 FNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRI 176
            ...|..|....||.|        |.:|                :.|:|..|.:|::.|..|....
plant   111 NGGRDVVFGPYGEYW--------RQMK----------------SVCILNLLTNKMVASFEKVREE 151

  Fly   177 EMHDL----------TSVYVLNTLWCMLS---------GRRYEPGSPEITQLLETFFELFKNIDM 222
            |::.:          :|...|:.|:..|:         |::|...        ||...|.|.:..
plant   152 EVNAMMEKLEKASCSSSAENLSELFVTLTSDVTSRVSLGKKYWED--------ETAGGLKKRVRQ 208

  Fly   223 VGALFSHFPLLRFI-----APNFSGYNG-FVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSY 281
            :..|...||:..::     ....:|:|. .||..|:....|.|.::.|....::..:..:::.|.
plant   209 IMELLREFPIGDYVPALAWIDRINGFNSKIVEVSRAYSDLMEKVVQEHLEAGEHKADFVNILLSI 273

  Fly   282 LRAQDEG-----NDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIK 341
            .:.::.|     ||.|.|.         ||||:.|..|::..|.:....|:..||..::...||:
plant   274 EKEKNNGFKVQRNDIKFMI---------LDMFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIR 329

  Fly   342 EVVGLERIPEWSRDRTK----LPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVI 402
            ..:.    |..|..:.|    :.|.:|:..|..|:.......:|.....|.::.||:|...|.|:
plant   330 STIR----PHGSYIKEKEVENMRYLKAVIKEVFRVHPPLPLILPRLLTEDVKVKGYDIAAGTEVL 390

  Fly   403 ACFRGMLINPVDF-PDPESFNPDRYL---FDGH---LKLPEAFNPFGFGRHRCMG---------- 450
            .....:..:|..: ||.|.|.|:|:|   .|.|   ||    :.|||.||..|.|          
plant   391 INAWSIHRDPAIWGPDAEEFKPERHLDSTLDYHGQDLK----YIPFGSGRRICPGINLAMGLVEV 451

  Fly   451 ---DLLGR 455
               :|:||
plant   452 TLANLVGR 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 106/496 (21%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 107/504 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.