DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP81F2

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_200532.1 Gene:CYP81F2 AraportID:AT5G57220 Length:491 Species:Arabidopsis thaliana

Alignment Length:496 Identity:116/497 (23%)
Similarity:209/497 (42%) Gaps:57/497 (11%)


  Fly     1 MFYTVIWIFCATLL---AILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFAR 62
            |.|.:|.:..|..|   ..||....:....||||..:||||          .|.:....:....|
plant     1 MDYVLIVLPLALFLIAYKFLFSSKTQGFNLPPGPTPFPIVG----------HLHLVKPPVHRLFR 55

  Fly    63 QYVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTNED---IDGRPDGIFYRLRTFNSRLGVLLTDG 123
            ::...|| .:.|:.|..:||:..:...:.|..|.::   :..||..:..:...::.........|
plant    56 RFAEKYGDIFSLRYGSRQVVVISSLPLVRESFTGQNDVILTNRPHFLTAKYVAYDYTTIGTAAYG 120

  Fly   124 EMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTR------IEMHDLT 182
            :.|...||.....:            :..|..|..|...||::.:...|.:|      :|:..|.
plant   121 DHWRNLRRICSLEI------------LSSNRLTGFLSVRKDEIRRLLTKLSREYDGRVVELEPLL 173

  Fly   183 SVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNI-DMVGALFSH----FPLLRFIAPNFSG 242
            :....|.:..|::||||........:....|.:|..:| |..||  ||    .|:|:...   .|
plant   174 ADLTFNNIVRMVTGRRYYGDQVHNKEEANLFKKLVTDINDNSGA--SHPGDYLPILKVFG---HG 233

  Fly   243 YNGFVES-HRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLD 306
            |...|:: ..::..|:.:.::..|:.    .|...::...|..|   .|:...:||..:..:.|.
plant   234 YEKKVKALGEAMDAFLQRLLDECRIN----GESNTMVSHLLSLQ---LDQPKYYSDVIIKGLMLS 291

  Fly   307 MFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVR 371
            |.|||::|...:|.:...:|:.:||:.::|..||.|.:|.||:.: ..|...|||.:.|..|..|
plant   292 MMLAGTDTAAVTLEWAMANLLKKPEVLKKAKAEIDEKIGEERLVD-EPDIANLPYLQNIVSETFR 355

  Fly   372 MFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLPE 436
            :.......:|.....|.::.||:||:.|:|:.....:..:|..:.:||.|.|:|:   ...:..:
plant   356 LCPAAPLLVPRSPSEDLKIGGYDIPRGTIVLVNAWAIHRDPRLWDEPEKFMPERF---EDQEASK 417

  Fly   437 AFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQ 477
            ....||.||..|.|..||::.:.:...:::|.|....:.|:
plant   418 KLMVFGNGRRTCPGATLGQRMVLLALGSLIQCFDWEKVNGE 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 109/467 (23%)
CYP81F2NP_200532.1 p450 1..483 CDD:299894 116/497 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.