DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP81D1

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_568533.2 Gene:CYP81D1 AraportID:AT5G36220 Length:502 Species:Arabidopsis thaliana

Alignment Length:526 Identity:131/527 (25%)
Similarity:223/527 (42%) Gaps:81/527 (15%)


  Fly     8 IFCATLLAILFGGVRKPKR--FPPG-PAWYPIVGS-ALQVSQLRCRLGMFCKVIDVFARQYVNPY 68
            ||....|.|.|..: |||:  .||. |.|.||:|. .|....:...|..|.:.:|     :.:..
plant    13 IFSLIFLIISFKFL-KPKKQNLPPSPPGWLPIIGHLRLLKPPIHRTLRSFSETLD-----HNDGG 71

  Fly    69 GFYGLKIGKDKV-VIAYTNDAISEMMTNEDI--DGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQR 130
            |...|::|...| |::....|..|.....|:  ..||..|..:...:|:...:....|:.|...|
plant    72 GVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVIIGKHVGYNNTNMIAAPYGDHWRNLR 136

  Fly   131 R------FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNT 189
            |      |....|..|.:.|:       :|...|:..|.   ..:|.|:|.:|:..:......|.
plant   137 RLCTIEIFSTHRLNCFLYVRT-------DEVRRLISRLS---RLAGTKKTVVELKPMLMDLTFNN 191

  Fly   190 LWCMLSGRRY--EPGSPEITQLLETFFELFKNIDMVGALFS------HFPLLRFIAPNFSGYNGF 246
            :..|::|:||  |..:.|     |....:.|.:..|||..|      :.|:||.    ||.|...
plant   192 IMRMMTGKRYYGEETTDE-----EEAKRVRKLVADVGANTSSGNAVDYVPILRL----FSSYENR 247

  Fly   247 V-----ESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLD 306
            |     |:.:.|...:..:        :...|....|..:|....:.:.|  .::||.:..|.|.
plant   248 VKKLGEETDKFLQGLIDDK--------RGQQETGTTMIDHLLVLQKSDIE--YYTDQIIKGIILI 302

  Fly   307 MFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVR 371
            |.:||:.|:..:|.:...:|:..|::..:|..||...|||:|:.| ..|.::|||.:.|.||.:|
plant   303 MVIAGTNTSAVTLEWALSNLLNHPDVISKARDEIDNRVGLDRLIE-EADLSELPYLKNIVLETLR 366

  Fly   372 MFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLPE 436
            :.......:||.|..|.::..|::|:.|.::.....:..:|..:.||:||.|:|:     .|..|
plant   367 LHPATPLLVPHMASEDCKIGSYDMPRGTTLLVNAWAIHRDPNTWDDPDSFKPERF-----EKEEE 426

  Fly   437 A--FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFK-----------MVAIPGQVPEEVPLEGAT 488
            |  ...||.||..|.|..|.::.:.:...:::|.|:           ...:...||:.:||: |.
plant   427 AQKLLAFGLGRRACPGSGLAQRIVGLALGSLIQCFEWERVGNVEVDMKEGVGNTVPKAIPLK-AI 490

  Fly   489 AAVKPY 494
            ...:|:
plant   491 CKARPF 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 119/489 (24%)
CYP81D1NP_568533.2 p450 15..489 CDD:299894 127/516 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.