DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71B12

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_197895.1 Gene:CYP71B12 AraportID:AT5G25130 Length:496 Species:Arabidopsis thaliana

Alignment Length:537 Identity:129/538 (24%)
Similarity:230/538 (43%) Gaps:92/538 (17%)


  Fly     1 MFYTVI-WIFCATLLAILFGGVRKPKR-FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQ 63
            ::|.:: ::|.::::.:..  :||.|: .||||...||:|:..|:.....| .||         :
plant     3 LWYIIVAFVFFSSMIIVRI--IRKTKKNLPPGPPRLPIIGNLHQLGSKPHR-SMF---------K 55

  Fly    64 YVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTD--- 122
            ....|| ...||.|....|:|.|.:.:.|::...|::  .||:      .|:.:|:...|.|   
plant    56 LSETYGPLMSLKFGSVSTVVASTPETVKEVLKTFDVECCSRPN------MTYPARVTYNLKDLCF 114

  Fly   123 ---GEMWVEQRR------FILRHLKNFGFAR----SGMMDIVHNEATCLLQ---DLKDKVLKSGG 171
               .:.|.|.|:      :..:.:::|...|    :.::|.:...|:  |:   :|..|::|..|
plant   115 SPYSKYWREVRKMTVVELYTAKRVQSFQHTRKEEVAALVDFIKQAAS--LEKPVNLNKKLMKLSG 177

  Fly   172 KQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVG--ALFSHFPLLR 234
                       ||.........|.|.:.|....|:.|         ..:::||  |...:||::.
plant   178 -----------SVICRVAFGINLQGSKLENTYEEVIQ---------GTVELVGSFAAADYFPVVG 222

  Fly   235 FIAPNFSGYNGFVES-HRSLYTFMSKEIELHRLTYKNYDE--PRDLMDSYLRAQDEGNDEKGMFS 296
            .|....:|.:...|. .:::..|..:.|: |.|.    ||  ..|::|..|: .:.|....|.|.
plant   223 RIIDRITGLHSKCEKLFKAMDAFFDQSIK-HHLE----DEIIKDDIIDLLLK-MERGETTLGEFQ 281

  Fly   297 -----DQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVV-GLERIPEWSRD 355
                 .:.:||..|:   ||.:|:.:.:.:...:|:..|.:.::|..|::||: ..:.|.|  .|
plant   282 LTRDHTKGILANILN---AGIDTSAQVMTWVMTYLISNPRVLKKAQAEVREVIKHKDDIIE--ED 341

  Fly   356 RTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPES 420
            ..:|.|.:.:..|..|:..|....||..|..|.::.||.|||.|.:......:..||..:.|||:
plant   342 IERLQYLKMVIKETFRINPLVPLLIPREASKDVKIGGYNIPKKTWIHVNIWAIHRNPNVWKDPEA 406

  Fly   421 FNPDRYLFDGHLKLPEAFN----PFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEE 481
            |.|:|:: |..:.. :..|    |||.||..|.|..:|...:.:....:|..|......|....:
plant   407 FIPERFM-DSQIDY-KGLNFELLPFGSGRRICPGIGMGMALVHLTLINLLYRFDWKLPEGMKVAD 469

  Fly   482 VPLEGATAAVKPYDIML 498
            |.||.:...|.|..|.|
plant   470 VDLEESYGLVCPKKIPL 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 117/489 (24%)
CYP71B12NP_197895.1 p450 1..490 CDD:299894 129/538 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.