DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp303a1 and CYP71A15

DIOPT Version :9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 / 49165 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_197877.1 Gene:CYP71A15 / 832565 AraportID:AT5G24950 Length:496 Species:Arabidopsis thaliana


Alignment Length:484 Identity:114/484 - (23%)
Similarity:189/484 - (39%) Gaps:85/484 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIWIFCATLLAILFGGVRKP--------KRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFA 61
            :|.:..||:||.|   :.||        ...||.|...|::|:..|:|....|          ..
plant     5 IISLCLATILAFL---LLKPLLNRTVAKDNLPPSPWRVPVIGNLHQLSLHPHR----------SL 56

  Fly    62 RQYVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTNED--IDGRPDGIFYRLRTFNSRLG-----V 118
            |...:.|| ...|..|:..:::..::|...::|...|  :..||     ||:...:.|.     |
plant    57 RSLSHRYGPLMLLHFGRVPILVVSSSDVAHDLMKTHDLKVANRP-----RLKVIETILNGGREVV 116

  Fly   119 LLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTS 183
            ....|:.|.:.:...:.||.|....:| ...:...|.:.::    :||.|:....:.:.:..|..
plant   117 FSPYGDYWRQIKTVCVVHLLNKKMVQS-FAKVREEERSVMM----EKVEKASSDSSPLNLSKLLI 176

  Fly   184 VYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKN-----IDMVGA--LFSHFPLLRFIAPNFS 241
            ....:....:..|:::..         |.....|||     .::||.  :..:.|.|.:|.....
plant   177 TLTSDVASRVSFGKKHSN---------EASMSDFKNQVRKITELVGGFPVSEYIPCLAWIDQIRG 232

  Fly   242 GYNGFVESHRSLYTFMSKEIELH-RLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICL 305
            .||...|..:.....|.|.::.| ..|.|...:..|::.|:.|...:|.:.:.  ||  :..|.|
plant   233 LYNRAEEVSKIFGDLMDKVVQEHLDATNKPTKDFVDILLSFERQSKDGIEVRR--SD--IKFIIL 293

  Fly   306 DMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIK-EVVGLE--RIPEWSRDRTKLPYCEAITL 367
            |:||.|:.|||..|.:....|:..||..::...||: :...|.  |..|...|   :.|.:|:..
plant   294 DIFLGGTTTTNSLLEWTMTELIRHPECMKKLQDEIRGDATNLTIYRSHEEVED---MKYLKAVIK 355

  Fly   368 EAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVI----ACFRGMLINPVDFPDPESFNPDRYLF 428
            |.:|:.......:......|.:|.||:|...|.||    |..|.::...:   |.|.|.|:|   
plant   356 EGLRLHPPFPLLVLRLLTQDVKLKGYDIAAGTQVITNAWAIQRDIVTWGI---DAEEFRPER--- 414

  Fly   429 DGHLKLPEAFN-------PFGFGRHRCMG 450
              ||..|..|.       |||.||..|.|
plant   415 --HLDSPLDFRGTNFEYIPFGSGRRICPG 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 106/453 (23%)
CYP71A15NP_197877.1 p450 28..493 CDD:299894 106/458 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.