DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP91A2

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_195459.1 Gene:CYP91A2 AraportID:AT4G37430 Length:500 Species:Arabidopsis thaliana

Alignment Length:547 Identity:139/548 (25%)
Similarity:222/548 (41%) Gaps:119/548 (22%)


  Fly    13 LLAILFGGV------RKPKRF--PPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG 69
            ||.:||..:      .|.:||  ||||...|.||          .|.:....|....::|.|.||
plant     6 LLPLLFLVISYKFLYSKTQRFNLPPGPPSRPFVG----------HLHLMKPPIHRLLQRYSNQYG 60

  Fly    70 -FYGLKIGKDKVVIAYTNDAISEMMTNED---IDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQR 130
             .:.|:.|..:||:..:.....|..|.::   :..||..:..:...:|.........|:.|...|
plant    61 PIFSLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGTAPYGDHWRNLR 125

  Fly   131 RF----IL--RHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLK-------------SGGKQTRI 176
            |.    ||  ..|.||...|                  ||::|:             .....|.|
plant   126 RICSQEILSSHRLINFQHIR------------------KDEILRMLTRLSRYTQTSNESNDFTHI 172

  Fly   177 EMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMV-GALFS--HFPLLRFIAP 238
            |:..|.|....|.:..|::|:||........:..|.|.:|..:|.|. ||..|  :.|:|:....
plant   173 ELEPLLSDLTFNNIVRMVTGKRYYGDDVNNKEEAELFKKLVYDIAMYSGANHSADYLPILKLFGN 237

  Fly   239 NFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGN-----------DEK 292
            .|                 .||:   :...|:.|:....:....|...|||           .:.
plant   238 KF-----------------EKEV---KAIGKSMDDILQRLLDECRRDKEGNTMVNHLISLQQQQP 282

  Fly   293 GMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRT 357
            ..::|..:..:.:.|.|||:||:..:|.:...:|:..||:.|:|..||.|.:|.:|:.:.| |..
plant   283 EYYTDVIIKGLMMSMMLAGTETSAVTLEWAMANLLRNPEVLEKARSEIDEKIGKDRLIDES-DIA 346

  Fly   358 KLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFN 422
            .|||.:.:..|..|:|.:..|.||.....|.::.||::|:||:|:.....:..:|..:.:||.||
plant   347 VLPYLQNVVSETFRLFPVAPFLIPRSPTDDMKIGGYDVPRDTIVMVNAWAIHRDPEIWEEPEKFN 411

  Fly   423 PDRYLFDG------HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEE 481
            |||| .||      ..||    .|||.||..|.|..||::.:.:...:::|.|:...:.|   ||
plant   412 PDRY-NDGCGSDYYVYKL----MPFGNGRRTCPGAGLGQRIVTLALGSLIQCFEWENVKG---EE 468

  Fly   482 VPLEGAT-----------AAVKPYDIM 497
            :.:..:|           |..:|..||
plant   469 MDMSESTGLGMRKMDPLRAMCRPRPIM 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 125/495 (25%)
CYP91A2NP_195459.1 p450 1..492 CDD:299894 137/543 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.