DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP81F4

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_195457.1 Gene:CYP81F4 AraportID:AT4G37410 Length:501 Species:Arabidopsis thaliana

Alignment Length:506 Identity:124/507 (24%)
Similarity:212/507 (42%) Gaps:87/507 (17%)


  Fly     1 MF-YTVIWIFCATLLAILFGGVRKPKRF--PPGPAW-YPIVGSALQVSQLRCRLGMFCKVIDVFA 61
            || |.:|......|||..|....|.:|:  ||.|:: .||:|..|.:.....||         |.
plant     1 MFNYVIILPLALFLLAYKFFFTSKKQRYYLPPSPSYSLPILGHHLLIKPPVHRL---------FH 56

  Fly    62 RQYVNPYG--FYGLKIGKDKVVIAYTNDAISEMMTNED---IDGRPDGIFYRLRTFNSRLGVLLT 121
            | ..|.:|  || |::|..:.|:..::....|..|.::   :..||..:..:...:|.......:
plant    57 R-LSNIHGPIFY-LRLGSRRAVVISSSSLARECFTGQNDVIVSNRPRFLTSKYIAYNYTTIATTS 119

  Fly   122 DGEMWVEQRRFI------LRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIE--M 178
            .|:.|...||..      .:.|.||...|.   :.:....|.|.:|.:      .||:..:|  :
plant   120 YGDHWRNLRRICSLEIVSSKRLANFLHIRK---EEIQRMLTRLSRDAR------VGKEVELESIL 175

  Fly   179 HDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGY 243
            :|||    .|.:..|::|:.|.  ..:::...|.  ||||.            |..||..| || 
plant   176 YDLT----FNNIVRMVTGKIYY--GDDVSDKEEA--ELFKK------------LFTFITTN-SG- 218

  Fly   244 NGFVESHRSLY-TFM-------SKEIELHRLTYKNYDEPRDLMDSYLRAQDEGN----------- 289
                ..|...| .||       .||:   :...|..||....:....::..:||           
plant   219 ----ARHPGEYLPFMKIFGGSFEKEV---KAAAKVIDEMLQRLLDECKSDKDGNTMVNHLLSLQQ 276

  Fly   290 DEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSR 354
            |:...::|..:..:.|.:.:|.|||:..::.:....|:..|::.::...||.|::|.:|:.|.| 
plant   277 DDPEYYTDIIIKGLMLGIMVASSETSALTIEWAMASLLNHPKVLDKVKLEIDEIIGQDRLIEES- 340

  Fly   355 DRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPE 419
            |...|||.:.:..|.:|:.......:|.....|.::.||::|:||||:.....:..:|..:.:||
plant   341 DIANLPYLQNVVSETLRLHPAAPVLVPRSTAEDIKIGGYDVPRDTMVMVNAWAIHRDPDLWTEPE 405

  Fly   420 SFNPDRYL-FDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNF 469
            .|||:|:. .:|..........||.||..|.|..|..:.:.:...:::|.|
plant   406 RFNPERFNGGEGEKDDVRMLIAFGSGRRICPGVGLAHKIVTLALGSLIQCF 456

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 114/477 (24%)
CYP81F4NP_195457.1 p450 1..498 CDD:299894 124/507 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.