DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP83B1

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_194878.1 Gene:CYP83B1 AraportID:AT4G31500 Length:499 Species:Arabidopsis thaliana

Alignment Length:559 Identity:122/560 (22%)
Similarity:214/560 (38%) Gaps:163/560 (29%)


  Fly    13 LLAILFGGV------------RKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYV 65
            ||.|:.|.|            :|..|.||||...||:|:..|:.:.                   
plant     3 LLLIIAGLVAAAAFFFLRSTTKKSLRLPPGPKGLPIIGNLHQMEKF------------------- 48

  Fly    66 NPYGF-------YG----LKIGKDKVVIAYTNDAISEMMTNEDID----------------GRPD 103
            ||..|       ||    :|||..::.:..:.:...|::..:|::                ||..
plant    49 NPQHFLFRLSKLYGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSYQGREL 113

  Fly   104 GI-----FYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLK 163
            |.     :||                   |.|:..:.:|  |...|......|..| .|  |.:.
plant   114 GFGQYTAYYR-------------------EMRKMCMVNL--FSPNRVASFRPVREE-EC--QRMM 154

  Fly   164 DKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLS-GRRYEPGSPEITQLLETFFELFKNIDMVGALF 227
            ||:.|:..:...:::.:|...:. |.:.|..: |:||.....|:.:.::.   |::...::|.||
plant   155 DKIYKAADQSGTVDLSELLLSFT-NCVVCRQAFGKRYNEYGTEMKRFIDI---LYETQALLGTLF 215

  Fly   228 --SHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEI-ELHRLTYKNYDEPRD------------- 276
              ..||           |.||:::...|...:.|.. ||.....:..||..|             
plant   216 FSDLFP-----------YFGFLDNLTGLSARLKKAFKELDTYLQELLDETLDPNRPKQETESFID 269

  Fly   277 -LMDSYLRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEI 340
             ||..|   :|:....|  |:.:::.|:.||:.:.|::|....:.:...:|:..||..::|..|:
plant   270 LLMQIY---KDQPFSIK--FTHENVKAMILDIVVPGTDTAAAVVVWAMTYLIKYPEAMKKAQDEV 329

  Fly   341 KEVVG------LERIPEWSRDRTKLPYCEAITLEAVRM-----FMLHTFGIPHRAVCDTRLSGYE 394
            :.|:|      .|.||       .|||.:|:..|::|:     .:||     ...:.|.::.||:
plant   330 RSVIGDKGYVSEEDIP-------NLPYLKAVIKESLRLEPVIPILLH-----RETIADAKIGGYD 382

  Fly   395 IPKDTMVIACFRGMLINPVDFPD-PESFNPDRYL-------FDGHLKLPEAFN--PFGFGRHRCM 449
            ||..|::......:..:...:.| |..|.|:|::       |.|     :.|.  |||.||..|.
plant   383 IPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMNEHKGVDFKG-----QDFELLPFGSGRRMCP 442

  Fly   450 GDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGAT 488
            ...||...:.:....:|..|......|..||::.::..|
plant   443 AMHLGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVMT 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 113/523 (22%)
CYP83B1NP_194878.1 PLN03234 1..499 CDD:178773 122/560 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.