DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71A27

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana

Alignment Length:470 Identity:107/471 (23%)
Similarity:186/471 (39%) Gaps:79/471 (17%)


  Fly     5 VIWIFCATLLAILF-------GGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFAR 62
            :|.:...||||.||       ....||| .||.|...|::|:..|:..                 
plant     5 LISLCLTTLLAFLFLKPLLKRITTTKPK-LPPSPWRLPVIGNLHQLGP----------------- 51

  Fly    63 QYVNPYGF-------YG----LKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNS 114
               ||:.:       ||    |..|:..|::....|..:::|...|:.  .||......:.....
plant    52 ---NPHRYLHSLSLRYGPLMLLHFGRVPVLVVSCPDVTNDIMKTHDLKFANRPKSKAINIFMEGG 113

  Fly   115 RLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMH 179
            |..:....||.|...:...:.||.|....||  .:.:..|.   ::.:.:|:.::....:.:.:.
plant   114 RDIIFGPYGEDWKSMKSLGVVHLLNNKMVRS--FENLREEE---IKVMTEKLEEASSSSSSVNLS 173

  Fly   180 DLTSVYVLNTLWCMLS-GRRY--EPGSPEITQLLETFFELFKNIDMVGALF--SHFPLLRFIAPN 239
            .|. :.:.|.:.|.:: ||:|  |.|..:|..|:.|..|.|      |..|  ...|.|.:| ..
plant   174 KLL-MTLTNDIICRITLGRKYNEEEGGIDIKNLVMTSSEFF------GKFFFGDFIPSLAWI-DW 230

  Fly   240 FSGYNGFVES-HRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAI 303
            .||.:..::. :..|..|:...::.|  ...::.||.|.:|..|..|.: ..::..|....|:.|
plant   231 ISGIDDKMKDINNKLDCFLDSMVQEH--VDADHKEPSDFIDMLLLIQKD-KTKRFKFDRSDLILI 292

  Fly   304 CLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLE 368
            ..|||.:|:.||...|.:....|:..||..::...||.. .....:....::..|:.|...:..|
plant   293 LKDMFFSGTATTASQLEWTMTELMRHPECMKKLQDEINS-FSTHNLNVTEKEVEKMNYLHCVIKE 356

  Fly   369 AVRMFMLH-----TFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFP-DPESFNPDRYL 427
            .:|   ||     .|.:|..   |.:|.||:|...|.||.....:..||..:. |...:.|:|:.
plant   357 GLR---LHPSGPLLFRLPSE---DVQLKGYDISAGTHVIINAWALQRNPAIWGLDANEYRPERHF 415

  Fly   428 ---FDGHLKLPEAFN 439
               .|.::.:|.:|:
plant   416 GTNLDFNVLIPNSFH 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 97/441 (22%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 97/442 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.