DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP705A2

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_193270.1 Gene:CYP705A2 AraportID:AT4G15350 Length:509 Species:Arabidopsis thaliana

Alignment Length:500 Identity:116/500 (23%)
Similarity:191/500 (38%) Gaps:107/500 (21%)


  Fly    23 KPK------RFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FYGLKIGKDKV 80
            |||      ..||.|...||:|        ...|.:...:.....::..:.|| ...|:|....:
plant    24 KPKDSRDGRDLPPSPPSLPIIG--------HLHLILLSTLTHKSFQRLSSKYGPLLHLRIFHVPI 80

  Fly    81 VIAYTNDAISEMMTNEDID---------------------GRPDGIFYRLRTFNSRLGVLLTDGE 124
            |:|.:.....|:..::|::                     ..|.|.:::   |..:|.|....|.
plant    81 VLASSASVAYEIFRDQDVNVSFRHSPPIEESLFLGSYSFISAPYGDYWK---FMRKLMVTKILGP 142

  Fly   125 MWVEQ-RRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLN 188
            ..:|: |||....|..|                  .:.|.||.:|....:...|...|.:    |
plant   143 QALERSRRFREDELDRF------------------YKTLLDKAMKKESVEIVEEAAKLNN----N 185

  Fly   189 TLWCMLSGR--RYEPGSPE-ITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESH 250
            |:..|:.||  ..|.|..| |..|:.....|.|.|.:  |...|.||.:.....|.  ...:...
plant   186 TICKMIMGRSCSEETGEAERIRGLVTESMALTKKIFL--ATIFHKPLKKLGISLFK--KEIMSVS 246

  Fly   251 RSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDE--------KGMFSDQSLLAICLDM 307
            |.....:.|.:..|....:.:.:..|:||..|.|..:.|.|        |.||         :|:
plant   247 RKFDELLEKILVEHEEKMEEHHQGTDMMDVLLEAYRDENAEYKITRNHIKSMF---------VDL 302

  Fly   308 FLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRM 372
            |:||::|::.::.:....::..|:|.||..:||..|||..|:.: ..|...|.|.:||..|.:| 
plant   303 FIAGTDTSSTTIQWIMAEIINHPKILERLREEIDFVVGKTRLIQ-ETDLPNLLYLQAIIKEGLR- 365

  Fly   373 FMLHTFG--IPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLF------- 428
              ||..|  :|........:.|:.||:.|:::.....::.:|..:.||:.|.|:|:|.       
plant   366 --LHPPGPLLPRTVQERCEIKGFHIPEKTILVVNSYAIMRDPDFWEDPDEFKPERFLSISRSGQE 428

  Fly   429 ----DGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNF 469
                |..||    :.||..||..|.|..|...::......::|.|
plant   429 DEIRDKFLK----YIPFASGRRGCPGTNLAYASVGTAVGVMVQCF 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 113/489 (23%)
CYP705A2NP_193270.1 p450 52..508 CDD:299894 106/464 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.