DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP83A1

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_193113.1 Gene:CYP83A1 AraportID:AT4G13770 Length:502 Species:Arabidopsis thaliana

Alignment Length:524 Identity:121/525 (23%)
Similarity:228/525 (43%) Gaps:76/525 (14%)


  Fly    11 ATLLAILFGGVRKPK----RFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG-F 70
            |.||..|:   :|||    :.||||:..|::|:.||:.:|..:.         |...:...|| .
plant    13 AVLLFFLY---QKPKTKRYKLPPGPSPLPVIGNLLQLQKLNPQR---------FFAGWAKKYGPI 65

  Fly    71 YGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFI 133
            ...:||...:|:..:.:...|::..:|::  .||....:...::..|...|......:.|.|:..
plant    66 LSYRIGSRTMVVISSAELAKELLKTQDVNFADRPPHRGHEFISYGRRDMALNHYTPYYREIRKMG 130

  Fly   134 LRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLS-GR 197
            :.||  |...|......|..|..   :.:.||:.|:..|...:::.:|...:. |::.|..: |:
plant   131 MNHL--FSPTRVATFKHVREEEA---RRMMDKINKAADKSEVVDISELMLTFT-NSVVCRQAFGK 189

  Fly   198 RYEPGSPEITQLLETFFELFKNIDMVGALF--SHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKE 260
            :|.....|:.:.::.   |:....::|.:|  ..||           |.||::....|..:|.:.
plant   190 KYNEDGEEMKRFIKI---LYGTQSVLGKIFFSDFFP-----------YCGFLDDLSGLTAYMKEC 240

  Fly   261 IE-----LHRLTYKNYDEPR---------DLMDSYLRAQDEGNDEKGMFSDQSLLAICLDMFLAG 311
            .|     :..:..:..|..|         ||:....:.|...::    |:..::.|:.||:.:||
plant   241 FERQDTYIQEVVNETLDPKRVKPETESMIDLLMGIYKEQPFASE----FTVDNVKAVILDIVVAG 301

  Fly   312 SETTNKSLGFCFMHLVLQPEIQERAFQEIKEVV---GLERIPEWSRDRTKLPYCEAITLEAVRMF 373
            ::|...::.:...:|:..|::.::|..|::|.:   |...:.|  .|...|||..|:..|.:|:.
plant   302 TDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMKEKGSTFVTE--DDVKNLPYFRALVKETLRIE 364

  Fly   374 MLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDF-PDPESFNPDRYL-----FDGHL 432
            .:....||...:.||:::||:||..|.|......:..:..:: |:|:.|.|:|:|     |.|  
plant   365 PVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEWGPNPDEFRPERFLEKEVDFKG-- 427

  Fly   433 KLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGAT--AAVKPYD 495
             ....|.|||.||..|.|..||...|.:....:|.:|......|..|:::.::..|  |..|...
plant   428 -TDYEFIPFGSGRRMCPGMRLGAAMLEVPYANLLLSFNFKLPNGMKPDDINMDVMTGLAMHKSQH 491

  Fly   496 IMLV 499
            :.||
plant   492 LKLV 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 109/481 (23%)
CYP83A1NP_193113.1 PLN02966 1..502 CDD:178550 121/525 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.