DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP706A4

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_192967.1 Gene:CYP706A4 AraportID:AT4G12300 Length:516 Species:Arabidopsis thaliana

Alignment Length:520 Identity:120/521 (23%)
Similarity:209/521 (40%) Gaps:107/521 (21%)


  Fly     3 YTVIW-IFCATLLAILFGGVRKPK-RFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYV 65
            ::::| ||           .|.|: ..||||...||||:          |......:..:.....
plant    27 FSILWYIF-----------KRSPQPSLPPGPRGLPIVGN----------LPFLDPDLHTYFANLA 70

  Fly    66 NPYG-FYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTD-GEMW 126
            ..:| .:.|.:|....::..:.....|::.::||:  .|...:..|..|:.. :.::.|. |..|
plant    71 QSHGPIFKLNLGSKLTIVVNSPSLAREILKDQDINFSNRDVPLTGRAATYGG-IDIVWTPYGAEW 134

  Fly   127 VEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKS-------------------GGK 172
            .:.|:.                        |:|:.|..|.|.|                   |.|
plant   135 RQLRKI------------------------CVLKLLSRKTLDSFYELRRKEVRERTRYLYEQGRK 175

  Fly   173 QTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIA 237
            |:.:::.|...:.::|....||.|     ||.:..::.....|....|..:..|.|.        
plant   176 QSPVKVGDQLFLTMMNLTMNMLWG-----GSVKAEEMESVGTEFKGVISEITRLLSE-------- 227

  Fly   238 PNFSGY---------NGFVE----SHRSLYTFMSKEIE-LHRLTYKNYDEPRDLMDSYLRAQDEG 288
            ||.|.:         .|.|:    ..|.|...:.:.|| :..|..::.||.:|.:...::.:|:.
plant   228 PNVSDFFPWLARFDLQGLVKRMGVCARELDAVLDRAIEQMKPLRGRDDDEVKDFLQYLMKLKDQE 292

  Fly   289 NDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWS 353
            .|.:...:...:.|:..||.:.|::|:..::.|....|:..||:.:||.:|:.||||.:.|.|.|
plant   293 GDSEVPITINHVKALLTDMVVGGTDTSTNTIEFAMAELMSNPELIKRAQEELDEVVGKDNIVEES 357

  Fly   354 RDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDP 418
            . .|:|||..||..|.:|:.......:|||...:|.:.||.|||||.:......:..:|..:.:|
plant   358 H-ITRLPYILAIMKETLRLHPTLPLLVPHRPAENTVVGGYTIPKDTKIFVNVWSIQRDPNVWENP 421

  Fly   419 ESFNPDRYLFDGHLKLPEA---FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPE 480
            ..|.|:|:|.:.......|   :.|||.||..|.|..|..:.:.....|:|.:|..     ::||
plant   422 TEFRPERFLDNNSCDFTGANYSYFPFGSGRRICAGVALAERMVLYTLATLLHSFDW-----KIPE 481

  Fly   481  480
            plant   482  481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 114/492 (23%)
CYP706A4NP_192967.1 p450 17..512 CDD:299894 120/521 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.