DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71B30P

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_190897.1 Gene:CYP71B30P AraportID:AT3G53290 Length:407 Species:Arabidopsis thaliana

Alignment Length:441 Identity:93/442 (21%)
Similarity:171/442 (39%) Gaps:70/442 (16%)


  Fly    84 YTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHL------KNF 140
            |.:.:..|::...|::  .||..:...|.::|.:.......||.|.|.::.|...|      |:|
plant     6 YLSSSAKEVLKTHDLETCTRPKMVTTGLFSYNFKDIGFTQYGEEWGEMKKLIGLELFSPKTQKSF 70

  Fly   141 GFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEP-GSP 204
            .:.|....|:           |..|:.||...||.:::......:....::.:..|:.:.. ...
plant    71 RYIREEESDL-----------LVKKISKSAQTQTLVDLGKPLFSFTAGIIFRLAFGQNFRKCDFI 124

  Fly   205 EITQLLETFFELFKNIDMVGALFSHFPL-LRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTY 268
            :..::.|...|...|:..: |....||. |.::....||.:..:....|..|.:.:.:....|..
plant   125 DRERVEELVVESETNVGTL-AFSDFFPTGLGWLIDRLSGQSSRMNKVFSKLTNLFEHVIDDHLKT 188

  Fly   269 KNYDEPRDLMDSYLRAQDEGNDEKGMF---SD--QSLLAICLDMFLAGSETTNKSLGFCFMHLVL 328
            :.:.:..:|:.:.|...::..: .|.|   ||  :.::::.:..||.|:                
plant   189 EQHQDHSNLISAMLNMINKPTN-IGSFKITSDHLKGVMSVSVYDFLTGT---------------- 236

  Fly   329 QPEIQERAFQEIKEVVG--LERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLS 391
                      .|:..:|  .|||.|  .|..|:.|.:.:..|..|:.......:|...:.|..:.
plant   237 ----------LIRATLGSNKERITE--EDLEKVEYLKMVIEETFRLHPPAPLLLPRLTMSDVTIQ 289

  Fly   392 GYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-----FDG-HLKLPEAFNPFGFGRHRCMG 450
            ||.|||:||:......:..:|..:.:||.|.|:|:.     :.| |.:|    .|||.||..|.|
plant   290 GYNIPKNTMIEINTYTIGRDPKCWTNPEEFIPERFSNTSINYKGQHFEL----LPFGAGRRSCPG 350

  Fly   451 DLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLE--GATAAVKPYDIMLV 499
            ..||...|.:....:|..|......|....::.:|  ||....|...:.||
plant   351 MSLGITILELGLLNLLYFFDWRLPNGMTIADIDMEEVGALNIAKKVPLELV 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 87/419 (21%)
CYP71B30PNP_190897.1 p450 11..405 CDD:299894 92/437 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.