DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71A21

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_680111.1 Gene:CYP71A21 AraportID:AT3G48320 Length:490 Species:Arabidopsis thaliana

Alignment Length:475 Identity:114/476 (24%)
Similarity:185/476 (39%) Gaps:98/476 (21%)


  Fly    14 LAILFGGVRKPKR-----FPPGPAWYPIVGSALQVS----QLRCRLGMFCKVIDVFARQYVNPYG 69
            :.|||  .:|.||     .|..|...|::|:..|:.    :..|.|.              :.||
plant    16 ITILF--FKKQKRGKKSNTPRSPPRLPLIGNLHQLGHHPHRSLCSLS--------------HRYG 64

  Fly    70 -FYGLKIGKDKVVIAYTNDAISEMMTNED--IDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR 131
             ...|.:|:..|::..:.|...:::...|  ...||....:....::.|.......||.|.:.:.
plant    65 PLMLLHLGRVPVLVVSSADVARDILKTHDRVFASRPRSKLFEKLFYDGRDVAFAPYGEYWRQIKS 129

  Fly   132 F-ILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIE------MHDLTSVYVLNT 189
            . :||.|.|      .|:....|.....:..:.:|:.||...|..:.      .:|:.|...|  
plant   130 VCVLRLLSN------KMVTSFRNVRQEEISLMMEKIQKSSSLQVNVSELLGSLTNDVISRIAL-- 186

  Fly   190 LWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFS---HFPLLRFIAPNFSGYNGFV-ESH 250
                  ||:|. |..:..       ||.|.:.|:...||   :.|.|.:| ...||.:|.: ::.
plant   187 ------GRKYS-GETDSK-------ELMKRLMMLMGEFSVGTYVPWLGWI-DWISGLDGQLNKTG 236

  Fly   251 RSLYTFMSKEIELHRLTYKNYDEPR-DLMDSYLRAQDEGNDEKGMFSDQ-SLLAICLDMFLAGSE 313
            ..|..|:.|.::.|    .:.|..| |.:|..||.|.|  ...|...|: .:.||.||:.:||::
plant   237 NDLDEFLEKVVQDH----VDGDGQRTDFVDVLLRIQRE--KSIGFEIDRLCIKAIVLDVLVAGTD 295

  Fly   314 TTNKSLGFCFMHLVLQPEIQERAFQEIKEVV-GLERIPEWSRDRTKLPYCEAITLEAVRMFMLHT 377
            ::...:.:....|:..||......:|::.:. |...:.|  .|...:.|.:|:..|..|:.....
plant   296 SSYALMDWAMTELLRHPECLRTLQEEVRTICKGNLSVSE--EDIQNMSYLKAVIKETTRLHPPLP 358

  Fly   378 FGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDF--------PDPESFNPDRYL-----FD 429
            ...||.::.|..|..|.||..|.|       :||....        ||.|.|.|:|:|     |.
plant   359 LLAPHESIQDVILGDYHIPAGTQV-------MINAWAIGREAATWGPDAEKFRPERHLDSSVDFR 416

  Fly   430 GH-LKLPEAFNPFGFGRHRC 448
            || .:|.    |||.||..|
plant   417 GHNFELV----PFGAGRRIC 432

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 108/457 (24%)
CYP71A21NP_680111.1 p450 1..482 CDD:299894 114/476 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.