DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71B34

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_189261.1 Gene:CYP71B34 AraportID:AT3G26300 Length:500 Species:Arabidopsis thaliana

Alignment Length:535 Identity:126/536 (24%)
Similarity:219/536 (41%) Gaps:82/536 (15%)


  Fly     4 TVIW----IFCATLLAILFG--GVRKPKRFPPGPAWYPIVGSALQVSQL-RCRLGMFCKVIDVFA 61
            |.||    ||...:|..:|.  ..|..:|.||.|...||:|:..|:.:| ...|....|.     
plant     2 TNIWLLSLIFVICILVAVFNHKNRRNYQRTPPSPPGCPIIGNLHQLGELPHQSLWKLSKK----- 61

  Fly    62 RQYVNPYGFYG----LKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLL 120
                     ||    ||:|:...||..:::...:.:...|:.  .||.....|..::| .|.:..
plant    62 ---------YGPVMLLKLGRVPTVIVSSSETAKQALKIHDLHCCSRPGFAGARELSYN-YLDIAF 116

  Fly   121 TD-GEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD---- 180
            :. .:.|.|.|:..::.|  |...:...:..:.:|.   ::.|.|.:.:|..::|.|.::.    
plant   117 SPYDDYWKEVRKLAVQEL--FSSKQVHSIQPIKDEE---VKKLIDSISESAAQKTPINLNKTLLA 176

  Fly   181 LTSVYVLNTLW------CMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPN 239
            ||...|..|.:      .:|:..|:.....|..::|.:|           :.....|.:..|...
plant   177 LTVSVVCRTAFSVNFEGTVLNSERFNNIVREALEMLGSF-----------SASDFIPYVGRIIDL 230

  Fly   240 FSGYNGFVE-SHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDE----GNDEKGMFSDQS 299
            .:|..|..| |.|.|..|..:..:||:  .|..:...|.:|..||.:.|    |||:   .:...
plant   231 LTGLQGRRERSMRDLDAFYEQMFDLHK--QKKEEGSEDFVDLLLRLEKEEAVLGNDK---LTRNH 290

  Fly   300 LLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIK-EVVGLERIPEWSRDRT-KLPYC 362
            :.||.:|:.|||.:|:..::.:....|...|.:.::...||: ::...|||   |.|.| ||.|.
plant   291 IKAILMDVLLAGMDTSAITMTWAMAELAKNPRVMKKVQSEIRSQIKNKERI---SFDDTDKLEYL 352

  Fly   363 EAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL 427
            :.:..|..|:.......||..|:.:..::||.||..|.:......:..:|..:.|||.|.|:|:.
plant   353 KMVIKETWRLHPTTPLLIPREAMSEFEINGYTIPVKTRLHVNVWAIGRDPDTWKDPEVFLPERFT 417

  Fly   428 FDG------HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEG 486
            .:.      |.:|    .|||.||..|....:|...:......:|.:|......|...:::.:|.
plant   418 DNNIDAKGQHFEL----LPFGGGRRMCPAVYMGTTMVEFGLANLLYHFDWKLPEGMKVDDIDMEE 478

  Fly   487 ATAAV--KPYDIMLV 499
            |....  |..:::||
plant   479 APGLTVNKKNELILV 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 112/483 (23%)
CYP71B34NP_189261.1 p450 7..498 CDD:299894 123/531 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.