DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71B4

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001325927.1 Gene:CYP71B4 AraportID:AT3G26280 Length:521 Species:Arabidopsis thaliana

Alignment Length:520 Identity:122/521 (23%)
Similarity:220/521 (42%) Gaps:118/521 (23%)


  Fly     4 TVIWIFCATLLAILF-----GGVRKPKR-FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFAR 62
            :::..|...|:.|.|     ..:::.|: .|||||..||:|:..|:.      |:..|.:...::
plant    20 SLLSFFLLLLVPIFFLLIFTKKIKESKQNLPPGPAKLPIIGNLHQLQ------GLLHKCLHDLSK 78

  Fly    63 QYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSR---LGVLLTD 122
            :: .|  ...|::|...:|:..:::|..|.:...|::  .||..:..|:.:.|.:   .||.   
plant    79 KH-GP--VMHLRLGFAPMVVISSSEAAEEALKTHDLECCSRPITMASRVFSRNGKDIGFGVY--- 137

  Fly   123 GEMWVEQRR------FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDL 181
            |:.|.|.|:      |.::.:::|.:.|....|:       :::.||:...|.........:..|
plant   138 GDEWRELRKLSVREFFSVKKVQSFKYIREEENDL-------MIKKLKELASKQSPVDLSKILFGL 195

  Fly   182 TSVYVLNTLWCMLSGRR-YEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNG 245
            |:..:..|.:    |:. ::....:...:.|..||...|:..   .||.|    |.......:.|
plant   196 TASIIFRTAF----GQSFFDNKHVDQESIKELMFESLSNMTF---RFSDF----FPTAGLKWFIG 249

  Fly   246 FVE-SHRSLY-------TFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDE----------- 291
            ||. .|:.||       ||.:..::.|.......|.| |::|:.|...|  |::           
plant   250 FVSGQHKRLYNVFNRVDTFFNHIVDDHHSKKATQDRP-DMVDAILDMID--NEQQYASFKLTVDH 311

  Fly   292 -KGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLE---RIPEW 352
             ||:.|         :::.||.:|:..:|.:....||..|.:.::|..||:..:|::   ||.| 
plant   312 LKGVLS---------NIYHAGIDTSAITLIWAMAELVRNPRVMKKAQDEIRTCIGIKQEGRIME- 366

  Fly   353 SRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLIN------ 411
             .|..||.|.:.:..|.:|:.......:|...:.|.::.||:||:.       |.:|:|      
plant   367 -EDLDKLQYLKLVVKETLRLHPAAPLLLPRETMADIKIQGYDIPQK-------RALLVNAWSIGR 423

  Fly   412 -PVDFPDPESFNPDRYL-----FDGHLKLPEAFN--PFGFGRHRCMGDL-------LGRQNLFMF 461
             |..:.:||.|||:|::     :.||     :|.  |||.||..|.|..       ||..||..|
plant   424 DPESWKNPEEFNPERFIDCPVDYKGH-----SFELLPFGSGRRICPGIAMAIATIELGLLNLLYF 483

  Fly   462  461
            plant   484  483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 117/491 (24%)
CYP71B4NP_001325927.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.