DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71B23

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_189252.1 Gene:CYP71B23 AraportID:AT3G26210 Length:501 Species:Arabidopsis thaliana

Alignment Length:528 Identity:114/529 (22%)
Similarity:220/529 (42%) Gaps:63/529 (12%)


  Fly     1 MFYTVIWIFCATLLAILFGGVRKPK----RFPPGPAWYPIVGSALQVSQL--RCRLGMFCKVIDV 59
            :|...:.:....|:.|:|  .||.:    :.||||...||:|:...::.|  :|.|         
plant     3 IFLCFLLLLLLLLVTIIF--TRKSQSSKLKLPPGPPKLPIIGNLHYLNGLPHKCLL--------- 56

  Fly    60 FARQYVNPYGFYG----LKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGV 118
                  |.:..:|    |::|...:|:..:|.|..|::...|:|  .||:.|..:..::|.:...
plant    57 ------NLWKIHGPVMQLQLGYVPLVVISSNQAAEEVLKTHDLDCCSRPETIASKTISYNFKDIG 115

  Fly   119 LLTDGEMWVEQRR------FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIE 177
            ....||.|...|:      |.|:...:|.:.|....|:           |..|:.::..||:.:.
plant   116 FAPYGEEWRALRKLAVIELFSLKKFNSFRYIREEENDL-----------LVKKLSEASEKQSPVN 169

  Fly   178 MHDLTSVYVLN-TLWCMLS-GRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFP---LLRFIA 237
            :.  .:::.|: ::.|.|: |:............:|......:.|....|..:.||   :|..|.
plant   170 LK--KALFTLSASIVCRLAFGQNLHESEFIDEDSMEDLASRSEKIQAKFAFSNFFPGGWILDKIT 232

  Fly   238 PNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMF--SDQSL 300
            ......|   |....|..|.::.::.|....:...|..|::|..:...:: ..:.|.|  :...:
plant   233 GQSKSLN---EIFADLDGFFNQVLDDHLKPGRKVLETPDVVDVMIDMMNK-QSQDGSFKLTTDHI 293

  Fly   301 LAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAI 365
            ..|..|:||||..|:..::.:....|:..|.:.::...|::.|:|.:|.....:|..:|.|.:.:
plant   294 KGIISDIFLAGVNTSATTILWAMTELIRNPRVMKKVQDEVRTVLGEKRDRITEQDLNQLNYFKLV 358

  Fly   366 TLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDG 430
            ..|..|:.......:|..|:...::.||:||:.|.::.....:..:|..:.:||.|.|:|::...
plant   359 IKETFRLHPAAPLLLPREAMAKIKIQGYDIPEKTQIMVNVYAIGRDPDLWENPEEFKPERFVDSS 423

  Fly   431 --HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPL--EGATAAV 491
              :..|.....|||.||..|.|..:|...:.:....:|..|......|:..:::.|  |||....
plant   424 VDYRGLNFELLPFGSGRRICPGMTMGIATVELGLLNLLYFFDWGLPEGRTVKDIDLEEEGAIIIG 488

  Fly   492 KPYDIMLV 499
            |...:.||
plant   489 KKVSLELV 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 101/475 (21%)
CYP71B23NP_189252.1 p450 40..500 CDD:299894 103/490 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.