DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP71B16

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_189246.1 Gene:CYP71B16 AraportID:AT3G26150 Length:502 Species:Arabidopsis thaliana

Alignment Length:547 Identity:126/548 (23%)
Similarity:227/548 (41%) Gaps:98/548 (18%)


  Fly     1 MFYTVIWIFCATLLAILFGGVRKPKR----FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFA 61
            |..:::.:|..||::::| .|:|.|.    .||.|..:|::|:..||.:|..|  .|.::.:...
plant     1 MAISLLCLFLITLVSLIF-VVKKIKHSKWDLPPSPPTFPVIGNLHQVGELPHR--SFQRLAERTG 62

  Fly    62 RQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRL--RTFNSRLGVLLTD 122
            ...:..:||.       .|.:..:.:|..|::...|:.  .||..:..||  |.|..   :..|.
plant    63 HVMLLHFGFV-------PVTVISSREAAEEVLRTHDLKCCTRPKLVGSRLISRGFKD---ISFTP 117

  Fly   123 -GEMWVEQRRFILRHL------KNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD 180
             ||.|.|:|:|::|.|      :.||:       ||..|...|::    |:.:|...:..:::..
plant   118 YGEEWRERRKFLVRELFCFKKVQYFGY-------IVEEECNLLVK----KLTESAVGRPPVDLSK 171

  Fly   181 LTSVYVLNTLWCMLSGRRYEPG----SPEITQLL---ETFFELFKNIDMVGALFSHFPL--LRFI 236
            .......:.|:.:..|:.:...    ..:|.:|:   ||....|...|.       ||:  |.::
plant   172 SLFWLAASILFRIAFGQSFHDNKFIDEDKIDELIFETETAQASFTCSDF-------FPIAGLGWL 229

  Fly   237 APNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEP------RDLMDSYLRA-QDEGNDEKGM 294
            |...||      .||.|.....|...|.:....::.:|      :|::|..|.. ..:|.|:...
plant   230 ADWISG------KHRWLNNVFFKLDALFQRVIDDHSDPGRWKDHKDIVDVMLDVMHKQGKDDSLR 288

  Fly   295 FSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVG--LERIPEWSRDRT 357
            .:...:.....::.:||.:|...::.:....|...||:.:....||::..|  .|||.:  .|..
plant   289 LTIDHIKGFLTNIIIAGIDTGALTMIWAMTELARNPELMKNVQGEIRDSFGNNKERITK--EDLN 351

  Fly   358 KLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLIN-------PVDF 415
            |:|:...:..|..|:..:....:|...:...::.||:||..       |.:|:|       |..:
plant   352 KVPFLNMVIKETFRLHPVAPLLLPRETMTHIKVQGYDIPPK-------RRILVNTWAIGRDPTLW 409

  Fly   416 PDPESFNPDRYL-----FDG-HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAI 474
            .:||.|||:|::     :.| |.:|    .|||.||..|.|..||...:.:....:|..|...|.
plant   410 INPEEFNPERFINNPVDYRGQHFEL----LPFGSGRRICPGMGLGITIVELGLLNLLYFFDWRAP 470

  Fly   475 PGQVPEEVPLE--GATAAVKPYDIMLV 499
            .|...:::..|  |....||...:.||
plant   471 DGMTHKDIDTEEAGILTVVKKVPLKLV 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 112/494 (23%)
CYP71B16NP_189246.1 p450 5..499 CDD:299894 125/544 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.