DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP76C3

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_182082.2 Gene:CYP76C3 AraportID:AT2G45580 Length:515 Species:Arabidopsis thaliana

Alignment Length:536 Identity:121/537 (23%)
Similarity:203/537 (38%) Gaps:123/537 (23%)


  Fly     9 FCATLLAILFGGVRKPKR------FPPGPAWYPIVGSALQVSQLRCR-LGMFCKVIDVFARQYVN 66
            |..||....| ...|.:|      .||||...|:||:..|:.....| |..|.|.          
plant    15 FLLTLFFFFF-ATAKTRRSSSTGTLPPGPPILPLVGNIFQLGFNPHRSLAAFSKT---------- 68

  Fly    67 PYG-FYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLG---------VLLT 121
             || ...||:|:...|:..:.:|..|.:...|       .....||||..|.         |.:.
plant    69 -YGPIMSLKLGRLTAVVISSPEAAKEALRTHD-------HVMSARTFNDALRAFDHHKHSIVWIP 125

  Fly   122 DGEMWVEQRRFILRHL---KNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDL-- 181
            ....|...::.|.::|   :|....:|..|..| .|...|:.:.::          |.|..||  
plant   126 PSARWRFLKKTITKYLLSPQNLDAIQSLRMRKV-EELVSLVNEFRE----------RGEAIDLAR 179

  Fly   182 ----TSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNI----DMVGA--LFSHFPLLRF- 235
                ||..:::.....:....|:..|        :.:|....:    |:.|.  :..:|..:|| 
plant   180 ASFVTSFNIISNALFSVDLATYDSNS--------SSYEFHNTVVHLTDIAGIPNVGDYFQYMRFL 236

  Fly   236 ------------IAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPR-----DLMDSYLR 283
                        |...|..:..|:::.      ::|...      :...||:     |::||.|.
plant   237 DLQGTRKKAVLCIEKLFRVFQEFIDAR------LAKRFS------RTEKEPKEASSIDMLDSLLD 289

  Fly   284 AQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLER 348
            ...:...|..|   ..|..:.||:|:||::|.:.::.:....|....|...:|..||::|:|...
plant   290 LTQQNEAELTM---NDLKHLLLDVFVAGTDTNSSTMEWAMTELFRSTEKMVKAQSEIRQVIGQNG 351

  Fly   349 IPEWSRDRTKLPYCEAITLEAVRMFMLHTFG--IPHRAVCDTRLSGYEIPKDTMVIACFRGMLIN 411
            ..:.| |...|||.:||..|.:|   ||...  ||.::..|.::.|:.:||:|.|:.....:..:
plant   352 FVQES-DIPSLPYLQAIVKETLR---LHPAAPLIPRKSESDVQIMGFLVPKNTQVVVNVWAIGRD 412

  Fly   412 PVDFPDPESFNPDRYLFDGHLKLPEA--------FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQN 468
            ...:.:|..|.|:|:|      |.|.        ..|||.||..|.|..:..:.:.|...::|.:
plant   413 ASVWENPMKFEPERFL------LRETDVKGRDFELIPFGSGRRMCPGISMALKTMHMVLASLLYS 471

  Fly   469 FKMVAIPGQVPEEVPL 484
            |......|.||..:.:
plant   472 FDWKLQNGVVPGNIDM 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 115/506 (23%)
CYP76C3NP_182082.2 p450 48..506 CDD:299894 110/503 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.