DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and CYP76C2

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_182081.1 Gene:CYP76C2 AraportID:AT2G45570 Length:512 Species:Arabidopsis thaliana

Alignment Length:525 Identity:119/526 (23%)
Similarity:211/526 (40%) Gaps:104/526 (20%)


  Fly     8 IFCATL-LAILFGGVRKPKR------FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYV 65
            :||..| ..|:|....:|:.      .||||...||:|:...|.:                    
plant    12 LFCFVLSFFIIFFTTTRPRSSRKVVPSPPGPPRLPIIGNIHLVGR-------------------- 56

  Fly    66 NP----------YG-FYGLKIGKDKVVIAYTNDAISEMMTNED--IDGR-PDGIFYRLRTFN-SR 115
            ||          || ...||.|....|:..:.:|..|::...|  :..| |..   .:|:.| .:
plant    57 NPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRTPTN---SIRSINHDK 118

  Fly   116 LGVLLTDGEMWV---EQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVL-----KSGGK 172
            :.|      :|:   ..|..:||.|     :.:.:......|||..|::.|.|.|     :|..:
plant   119 VSV------VWLPPSSSRWRLLRKL-----SATQLFSPQRIEATKTLRENKVKELVSFMSESSER 172

  Fly   173 QTRIEMHDLTSVYVLNTLWCMLSG---RRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLR 234
            :..:::...|.:..||.:..:|..   ..|:.....:.|  :|...:.:.:....|. :.||.|.
plant   173 EEAVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQ--DTVIGVMEAVGNPDAA-NFFPFLG 234

  Fly   235 FIAPN-------------FSGYNGFVE---SHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLR 283
            |:...             |..:.||::   :.:||....||::           ..||.:|..| 
plant   235 FLDLQGNRKTLKACSERLFKVFRGFIDAKLAEKSLRDTNSKDV-----------RERDFVDVLL- 287

  Fly   284 AQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLER 348
              |....::...:...::.:.||:|.||::|.:.::.:....|:..||...:|..||..|:|.:.
plant   288 --DLTEGDEAELNTNDIVHLLLDLFGAGTDTNSSTVEWAMAELLRNPETMVKAQAEIDCVIGQKG 350

  Fly   349 IPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPV 413
            :.|.| |.:.|||.:|:..|..|:.......:|.:|..|..:.|:.:||||.|......:..:|.
plant   351 VVEES-DISALPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVFVNVWAIGRDPN 414

  Fly   414 DFPDPESFNPDRYL-FDGHLKLPE-AFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPG 476
            .:.:...|.|:|:| .|..|:..: ...|||.||..|.|..|..:.:.:...::|.:|.. .:|.
plant   415 VWENSSRFKPERFLGKDIDLRGRDYELTPFGAGRRICPGLPLAVKTVPLMLASLLYSFDW-KLPN 478

  Fly   477 QVPEE 481
            .|..|
plant   479 GVGSE 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 112/496 (23%)
CYP76C2NP_182081.1 p450 47..506 CDD:299894 108/491 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.