DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2ad6

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001076405.1 Gene:cyp2ad6 ZFINID:ZDB-GENE-041001-157 Length:492 Species:Danio rerio

Alignment Length:502 Identity:139/503 (28%)
Similarity:233/503 (46%) Gaps:41/503 (8%)


  Fly     7 WIFCATLLAILFGGVR--KPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG 69
            |:|....|.:|...:|  .|..|||||...||:|:..        ..:..|.:|    |.:..||
Zfish    15 WLFLTCFLLLLIDLIRNKNPANFPPGPWPLPILGNVF--------TDVNYKTVD----QLIEKYG 67

  Fly    70 -FYGLKIGKDKVVIAYTNDAISEMM--TNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR 131
             .:.::||.||:|.......:.:::  ..|:...||....:  .|.....|:...:|..|.:.::
Zfish    68 NIFSVRIGSDKIVYVSGFKMVKDVLITQGENFTDRPVSPLF--DTLYKGRGLSFNNGYSWRKHQQ 130

  Fly   132 FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD-LTSV--YVLNTLWCM 193
            |.:.||||||..|..:.:  :|:..|..       |....|:.:....| |..:  .|.|.:..:
Zfish   131 FSMSHLKNFGEGRKTLEE--NNQRECYF-------LCGAFKEEQGRPFDPLVKINNAVANVIGFL 186

  Fly   194 LSGRRYEPGSPEITQLLETFFE-LFKNIDMVGALFSHFP-LLRFIAPNFSGYNGFVESHRSLYTF 256
            :.|.|||.......:.|:...| :|....:...|:..|| :::::.   ..:...:.:::.|..|
Zfish   187 VFGHRYEYSDVNFQKRLQMSAESVFLTGSVWNQLYDAFPGIMKWVP---GPHQTIISNYQKLANF 248

  Fly   257 MSKEIELHRLTYKNYDEPRDLMDSYL-RAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLG 320
            :.::||.|:..: :...|||.:|:|| .|:.:.||.:..|:..||:...:|:|..|:|||..:|.
Zfish   249 LEEKIEQHKPDW-DISNPRDYIDAYLTEAEKKKNDTEAGFTVGSLVWSMVDLFEGGTETTTNTLR 312

  Fly   321 FCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAV 385
            :..:.|:..|:||::...||.||:| .|:|..| |:..:.|..|...|.:|...|....:...|.
Zfish   313 WALLFLIKYPDIQKKVQAEIDEVIG-SRLPSMS-DKANMHYLNAFIHEVLRRANLVPLNMARVAK 375

  Fly   386 CDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEAFNPFGFGRHRCM 449
            .||.|.||.|.|.|::|.....:|.:..::..|::|||..:| .:||.....||..|..|:.:|.
Zfish   376 KDTTLGGYFITKGTVMITNLTSVLYDKQEWETPDAFNPKHFLDSEGHFCRRNAFFAFSAGKRQCP 440

  Fly   450 GDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDI 496
            |:.|....||:|.|.:||.|......|:.|......|.|.|..||.|
Zfish   441 GEYLAHLELFIFLTILLQTFSFSPPDGEEPSLDSQVGFTQAPLPYKI 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 126/462 (27%)
cyp2ad6NP_001076405.1 p450 38..488 CDD:278495 132/480 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.