DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2aa9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001073320.1 Gene:cyp2aa9 ZFINID:ZDB-GENE-080724-3 Length:499 Species:Danio rerio

Alignment Length:476 Identity:128/477 (27%)
Similarity:231/477 (48%) Gaps:39/477 (8%)


  Fly    26 RFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGFYG----LKIGKDKVVIAYTN 86
            ||||||...|.||:...:.:.              ..:::.....||    :.:|:...::..|.
Zfish    38 RFPPGPTPLPFVGNLPHLLKK--------------PMEFIRSLSQYGEMTTMYLGRKPAIVLNTY 88

  Fly    87 DAISEMMTNEDIDGRPDGIFYRLRTFNSRLG-VLLTDGEMWVEQRRFILRHLKNFGFARSGMMDI 150
            ....|.:..|...|||.  ...:......|| |::|....|.:||||....|:|||..:..:...
Zfish    89 QVAKEALVQEAFAGRPH--LPIIEWITKGLGIVMVTFNNSWKQQRRFAQHTLRNFGLGKKSLESR 151

  Fly   151 VHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFE 215
            |..|:..|:.::    ||..|:... ..|.:.:. :.|.:..::.|.|::..:.....||:...|
Zfish   152 VLEESQYLIAEM----LKDEGRPMN-PQHAVQNA-LSNIICSIVFGDRFDYNNKRFEYLLKILNE 210

  Fly   216 -LFKNIDMVGALFSHFPLLRFIAPNFSGYNGFV-ESHRSLYTFMSKEIELHRLTYKNYDEPRDLM 278
             :.......|.:|:..|:::    :|.|.:..: |:...:|:|:..|:|.||.|. :...|||.:
Zfish   211 SIILTGSAAGQIFNFAPIIK----HFPGPHQMINENANEVYSFVRHEVEEHRKTL-DPGSPRDFI 270

  Fly   279 DSY-LRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKE 342
            |.| |..:.:.:::...|.:.:|:...:|:|||||::|:.|:.:..:.|:..|::|||..:||.:
Zfish   271 DGYLLEIEKQKSNKDSTFHEDNLITTTVDLFLAGSDSTSSSIRWGLLFLIQNPDVQERCHEEIVQ 335

  Fly   343 VVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRG 407
            |:|.:|:| ...||.:|||..|...|..|...:..||:.|.....|:|.||.||:.|:::..:..
Zfish   336 VLGYDRLP-CMDDRDRLPYTLATVHEIQRCGNIAPFGLFHETAQPTKLRGYNIPQGTIIMTNYTA 399

  Fly   408 MLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471
            :..|...:..|::|||:.:|.: ||...|:.|..||.|...|:||.|.:..||:|.|::||..:.
Zfish   400 IFSNKEHWKHPDTFNPENFLDENGHFSKPKCFIAFGVGPRICLGDTLAKTALFLFITSLLQRIRF 464

  Fly   472 VAIPGQVPEEVPLEGATAAVK 492
            ...|...|  :.::|..:.::
Zfish   465 SLPPDAKP--MDMDGILSIIR 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 125/461 (27%)
cyp2aa9NP_001073320.1 RSN1_TM 10..>63 CDD:290675 9/39 (23%)
p450 40..488 CDD:278495 126/475 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.