DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2x9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001070921.1 Gene:cyp2x9 ZFINID:ZDB-GENE-061027-109 Length:491 Species:Danio rerio

Alignment Length:513 Identity:159/514 (31%)
Similarity:245/514 (48%) Gaps:41/514 (8%)


  Fly     2 FYTVIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVN 66
            |..::|| |..|| .||..:.:||.|||||...|:.|:.|:::     :....|..:..|.:|.|
Zfish     4 FLILVWI-CIVLL-FLFIQIPRPKNFPPGPRPLPLFGNLLELN-----INNPLKDFERLANRYGN 61

  Fly    67 PYGFYGLKIGKDKVVIAYTNDAISEMMTNEDID--GRPDGIFYRLRTFNSRLGVLLTD-GEMWVE 128
            .|..|   .|....|:....:|:.|.:..:.:|  |||..:.....|...  ||:|:| |..|.|
Zfish    62 IYSLY---FGSKPWVVLNGFEALKEALVTKAVDFAGRPQDLMVNRVTKGG--GVILSDYGPSWKE 121

  Fly   129 QRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCM 193
            .|||.|..|:|||..:..|.:.:..|.:.::..|:.:|..:...||.  .|:..|    |.:..:
Zfish   122 HRRFALMTLRNFGLGKQSMEERILGEVSHIIDKLEKRVGTAFDPQTM--FHNAAS----NIICIV 180

  Fly   194 LSGRRYEPGSPEITQLLETFFELF-KNIDMVGA----LFSHFPLLRFIAPNFSGYNGFVESHRSL 253
            |.|.||:...    :.|:.|..|: :|..:...    ::..||:.|::...|..........|.|
Zfish   181 LFGSRYDYDD----EFLKLFIHLYTENAKIANGPWAMIYDTFPMFRYLPLPFRKAFANASKAREL 241

  Fly   254 YTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKS 318
            .|.:.||   |:.|:.. .||||.:|.||...|:..::...||:..|:...||:..||::||:.:
Zfish   242 STQLVKE---HKKTWVP-GEPRDFIDCYLDELDKRGNDGSSFSEAQLILYVLDLHFAGTDTTSNT 302

  Fly   319 LGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWS-RDRTKLPYCEAITLEAVRMFMLHTFGIPH 382
            |...|::|:..||:|.:..|||.:|  ||...:.| .||..:||.:|:|.|..|:.......:.|
Zfish   303 LLTGFLYLMTHPEVQAKCQQEIDDV--LEDKDQASYEDRHSMPYTQAVTHEVQRVANTVPLSVFH 365

  Fly   383 RAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRH 446
            ....||.|.||.|||.|.||......|.....:..|..|||..:|.: |..:.||||.||..|..
Zfish   366 CTTKDTELMGYNIPKGTFVIPNLGSALKEEGQWKFPHEFNPANFLNEQGEFEKPEAFVPFSAGPR 430

  Fly   447 RCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQV--PEEVPLEGATAAVKPYDIMLVARE 502
            .|:|:.|.|..||:...|:|:.|:.| .|...  |:..|:.|.|...:||.:.:..||
Zfish   431 VCLGEGLARMELFLVMVTLLRRFQFV-WPNDAGKPDYTPVYGVTLTPQPYRMHIKRRE 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 141/464 (30%)
cyp2x9NP_001070921.1 p450 28..479 CDD:278495 145/478 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H111164
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.