DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and Cyp2j9

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_083255.1 Gene:Cyp2j9 MGIID:1921769 Length:502 Species:Mus musculus

Alignment Length:503 Identity:147/504 (29%)
Similarity:246/504 (49%) Gaps:37/504 (7%)


  Fly     5 VIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG 69
            |.::|.|..|.     .|:||.:||||...|.||....:...:..|.:         :|:|..||
Mouse    26 VTFLFLADFLK-----NRRPKNYPPGPMRLPFVGCLFHLDPKQPHLSL---------QQFVKKYG 76

  Fly    70 -FYGLKIGKDKVVIAYTNDAISEMMT--NEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRR 131
             ...|.......|:......|.|:.|  ..:...||..:. |...||.. |::.:..:.|.||||
Mouse    77 NVLSLDFANIPSVVITGMPLIKEIFTQMEHNFMNRPVTLL-RKHLFNKN-GLIFSSDQTWKEQRR 139

  Fly   132 FILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSG 196
            |.|..|:|||..:..:.:.:..||..|::.::|:    ||:.  .:.|...|..|.|.:..:..|
Mouse   140 FALMTLRNFGLGKRSLEERIQEEAHYLVEAIRDE----GGQP--FDPHFNISNAVSNIICSITFG 198

  Fly   197 RRYEPGSPEITQLLETFFE-LFKNIDMVGALFSHFP-LLRFIAPNFSGYNGFVESHRSLYTFMSK 259
            .|::....:..::|....| :.....|:..|::.|| :|:::.   ..:.....:.|.|..|:|.
Mouse   199 ERFDYHDSQFQEMLRLLDEAMCLESSMMCQLYNIFPRILQYLP---GSHQTLFRNWRKLQLFVSD 260

  Fly   260 EIELHRLTYKNYDEPRDLMDSYLRAQDEGNDE-KGMFSDQSLLAICLDMFLAGSETTNKSLGFCF 323
            .:..||..: :.|||||.:|::|....:..|: ...|::::|:...||:|.||:|||:.:|.:..
Mouse   261 IVNNHRRDW-DPDEPRDFIDAFLTEMTKYPDKTTTSFNEENLICSTLDLFFAGTETTSTTLRWAL 324

  Fly   324 MHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDT 388
            :.:.|.||:||:...||..|:|..|.|..: ||..:||..|:..|..||..:..|.:|.....||
Mouse   325 LCMALYPEVQEKMQAEIDRVIGQARQPNLA-DRDSMPYTNAVIHEVQRMGNIIPFNVPREVAVDT 388

  Fly   389 RLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKLPEAFNPFGFGRHRCMGDLL 453
            :|:|:.:||..||::....:..:|.::..|::|||:.:|.:|..|..|:|.||..|:..|:|:.|
Mouse   389 QLAGFNLPKGIMVLSNLTALHRDPSEWTTPDTFNPEHFLENGQFKKRESFLPFSMGKRACLGEQL 453

  Fly   454 GRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAA-VKPYDIMLVA 500
            .|..||:|.||:.|.|   .....|.|::.|:...|| |.|....|.|
Mouse   454 ARSELFIFITTLFQKF---TFKPPVNEKLSLQFRMAATVSPVSHRLCA 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 132/458 (29%)
Cyp2j9NP_083255.1 p450 44..497 CDD:278495 139/478 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C102677986
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.